PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Spipo24G0023500

Organism

Spirodela polyrhiza

Taxonomic ID

29656

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela

Family

MYB_related

Protein Properties

Length: 52aa MW: 5973.04 Da PI: 11.1741

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Spipo24G0023500	genome	MIPS/IBIS	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	43.7	6.4e-14	9	45	11	48
HHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 11 llvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 llvd+v+ +G + W+ Iar++ gR +kqc++rw+++l Spipo24G0023500 9 LLVDLVETYGDKKWSHIARMLV-GRVGKQCRERWHNHL 45 8*******************.***********97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	19.378	1	49	IPR017930	Myb domain
Gene3D	G3DSA:1.10.10.60	5.4E-18	8	50	IPR009057	Homeodomain-like
SMART	SM00717	1.1E-4	8	47	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	2.02E-13	8	50	IPR009057	Homeodomain-like
CDD	cd00167	9.42E-11	8	45	No hit	No description
Pfam	PF00249	7.5E-12	9	45	IPR001005	SANT/Myb domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 52 aa Download sequence Send to blast
MIGSGLGRLL VDLVETYGDK KWSHIARMLV GRVGKQCRER WHNHLRPNIK F*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1gv2_A	8e-14	10	50	15	55	MYB PROTO-ONCOGENE PROTEIN
1mse_C	8e-14	10	50	15	55	C-Myb DNA-Binding Domain
1msf_C	8e-14	10	50	15	55	C-Myb DNA-Binding Domain
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that binds to the motif 5'-GTAACNT-3' in the promoter of target genes (e.g. DD11 and DD18) and promotes their expression within synergid cells (e.g. in the filiform apparatus) in ovules (PubMed:16214903, PubMed:17693534, PubMed:18410484, PubMed:17937500). Required for the formation of the filiform apparatus during synergid cell differentiation in the female gametophyte (PubMed:16214903). Involved in pollen tube guidance to the micropyle (PubMed:16214903, PubMed:17937500, PubMed:23093426). {ECO:0000269\|PubMed:16214903, ECO:0000269\|PubMed:17693534, ECO:0000269\|PubMed:17937500, ECO:0000269\|PubMed:18410484, ECO:0000269\|PubMed:23093426}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_008453673.1	4e-20	PREDICTED: transcription factor MYB98-like
Refseq	XP_008813584.1	5e-20	uncharacterized protein LOC103724184
Refseq	XP_009394068.1	3e-20	PREDICTED: transcription factor MYB98-like isoform X1
Refseq	XP_010909135.1	4e-20	uncharacterized protein LOC105035310
Swissprot	Q9S7L2	5e-19	MYB98_ARATH; Transcription factor MYB98
TrEMBL	A0A1S3BWA8	9e-19	A0A1S3BWA8_CUCME; transcription factor MYB98-like
TrEMBL	A0A2H3ZHF6	1e-18	A0A2H3ZHF6_PHODC; uncharacterized protein LOC103724184
STRING	XP_008453673.1	2e-19	(Cucumis melo)
STRING	XP_008813584.1	2e-19	(Phoenix dactylifera)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP2806	37	88

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G18770.1	2e-21	myb domain protein 98

Link Out ? help Back to Top
Phytozome	Spipo24G0023500

Publications ? help Back to Top
Mendes MA, et al. Live and let die: a REM complex promotes fertilization through synergid cell death in Arabidopsis. Development, 2016. 143(15): p. 2780-90 [PMID:27338615]