![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Spipo29G0019400 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 145aa MW: 15834.8 Da PI: 4.8332 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 180.6 | 1.3e-56 | 32 | 126 | 1 | 95 |
NF-YB 1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrele 94
vreqdrflPian++rimkk+lPanaki+kdaketvqecvsefisf+tsea dkcq+ekrktingddllwa+atlGfe+y+epl++yl+kyrele
Spipo29G0019400 32 VREQDRFLPIANIGRIMKKALPANAKIAKDAKETVQECVSEFISFITSEACDKCQKEKRKTINGDDLLWAMATLGFEEYIEPLRIYLQKYRELE 125
69*******************************************************************************************9 PP
NF-YB 95 g 95
g
Spipo29G0019400 126 G 126
8 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 1.5E-53 | 29 | 126 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 5.28E-40 | 35 | 127 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 5.8E-29 | 38 | 102 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| PRINTS | PR00615 | 1.5E-21 | 66 | 84 | No hit | No description |
| PROSITE pattern | PS00685 | 0 | 69 | 85 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
| PRINTS | PR00615 | 1.5E-21 | 85 | 103 | No hit | No description |
| PRINTS | PR00615 | 1.5E-21 | 104 | 122 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 145 aa Download sequence Send to blast |
MAESSAPGQG PSSPEAGGSH EYAGEGSPQS NVREQDRFLP IANIGRIMKK ALPANAKIAK 60 DAKETVQECV SEFISFITSE ACDKCQKEKR KTINGDDLLW AMATLGFEEY IEPLRIYLQK 120 YRELEGPDMM QSQGQYLNGS GGRN* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1n1j_A | 1e-46 | 31 | 123 | 1 | 93 | NF-YB |
| 4awl_B | 1e-46 | 31 | 123 | 2 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
| 4csr_A | 1e-46 | 31 | 123 | 2 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_009767971.1 | 1e-71 | PREDICTED: nuclear transcription factor Y subunit B-10-like isoform X1 | ||||
| Refseq | XP_009767972.1 | 1e-71 | PREDICTED: nuclear transcription factor Y subunit B-10-like isoform X2 | ||||
| Refseq | XP_016510778.1 | 1e-71 | PREDICTED: nuclear transcription factor Y subunit B-10-like isoform X2 | ||||
| Refseq | XP_016510785.1 | 1e-71 | PREDICTED: nuclear transcription factor Y subunit B-10-like isoform X3 | ||||
| Swissprot | Q8VYK4 | 1e-63 | NFYB8_ARATH; Nuclear transcription factor Y subunit B-8 | ||||
| TrEMBL | A0A1S4DBH6 | 3e-70 | A0A1S4DBH6_TOBAC; nuclear transcription factor Y subunit B-10-like isoform X3 | ||||
| TrEMBL | A0A1S4DBQ2 | 3e-70 | A0A1S4DBQ2_TOBAC; nuclear transcription factor Y subunit B-10-like isoform X2 | ||||
| TrEMBL | A0A1U7VIT3 | 3e-70 | A0A1U7VIT3_NICSY; nuclear transcription factor Y subunit B-10-like isoform X2 | ||||
| TrEMBL | A0A1U7VSP9 | 3e-70 | A0A1U7VSP9_NICSY; nuclear transcription factor Y subunit B-10-like isoform X1 | ||||
| STRING | XP_009767971.1 | 5e-71 | (Nicotiana sylvestris) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP201 | 38 | 331 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G37060.3 | 5e-66 | nuclear factor Y, subunit B8 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Spipo29G0019400 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




