![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Spipo2G0051400 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
|
||||||||
| Family | LBD | ||||||||
| Protein Properties | Length: 89aa MW: 9872.36 Da PI: 7.0102 | ||||||||
| Description | LBD family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | DUF260 | 76.6 | 4.3e-24 | 10 | 87 | 3 | 84 |
DUF260 3 aaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklq 84
aaCk+l +kC + Cv+ py+p+e+++kf n+ ++FGa+nv k+l+++ + ++da++sl++eA+ dP++G++g i++lq
Spipo2G0051400 10 AACKYLHEKCIPCCVFTPYLPQEESAKFMNMYHFFGARNVAKILNHVLPVSHRDAVTSLYFEAD----DPINGCLGYIQALQ 87
8*************************************************************96....***********998 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50891 | 15.01 | 7 | 88 | IPR004883 | Lateral organ boundaries, LOB |
| Pfam | PF03195 | 3.5E-23 | 10 | 88 | IPR004883 | Lateral organ boundaries, LOB |
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 89 aa Download sequence Send to blast |
MASSSSPAYA ACKYLHEKCI PCCVFTPYLP QEESAKFMNM YHFFGARNVA KILNHVLPVS 60 HRDAVTSLYF EADDPINGCL GYIQALQH* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5ly0_A | 2e-24 | 10 | 88 | 13 | 95 | LOB family transfactor Ramosa2.1 |
| 5ly0_B | 2e-24 | 10 | 88 | 13 | 95 | LOB family transfactor Ramosa2.1 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Not known; ectopic expression of LOB leads to alterations in the size and shape of leaves and floral organs and causes male and female sterility. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Positively regulated within the shoot apex by both ASYMMETRIC LEAVES 1 (AS1) and ASYMMETRIC LEAVES 2 (AS2/LBD6) and by KNAT1. {ECO:0000269|PubMed:11934861}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AC254539 | 1e-122 | AC254539.1 Spirodela polyrhiza clone GNAS837-M21, complete sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_022004798.1 | 9e-27 | protein LATERAL ORGAN BOUNDARIES-like | ||||
| Swissprot | Q9FML4 | 8e-24 | LOB_ARATH; Protein LATERAL ORGAN BOUNDARIES | ||||
| TrEMBL | A0A251VF39 | 2e-25 | A0A251VF39_HELAN; Putative LOB domain-containing protein | ||||
| TrEMBL | A0A2N9ITT4 | 4e-25 | A0A2N9ITT4_FAGSY; Uncharacterized protein | ||||
| STRING | XP_010029135.1 | 7e-25 | (Eucalyptus grandis) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G63090.4 | 3e-26 | LBD family protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Spipo2G0051400 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




