PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Spipo3G0109000

Organism

Spirodela polyrhiza

Taxonomic ID

29656

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela

Family

TALE

Protein Properties

Length: 184aa MW: 20939.7 Da PI: 10.1583

Description

TALE family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Spipo3G0109000	genome	MIPS/IBIS	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Homeobox	28	3.8e-09	115	149	21	55
HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS Homeobox 21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 + +yps++e++ L +++gLt++q+++WF N+R ++ Spipo3G0109000 115 SWPYPSESEKAALVASTGLTQNQISNWFINQRKRH 149 569*****************************885 PP
2	ELK	27.6	6.8e-10	68	89	1	22
ELK 1 ELKhqLlrKYsgyLgsLkqEFs 22 ELK Ll+ Y+++L+sLkqE+s Spipo3G0109000 68 ELKSDLLKRYGEHLCSLKQELS 89 9*******************97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Pfam	PF03789	2.1E-5	68	89	IPR005539	ELK domain
SMART	SM01188	3.2E-4	68	89	IPR005539	ELK domain
PROSITE profile	PS51213	9.516	68	88	IPR005539	ELK domain
PROSITE profile	PS50071	12.471	89	152	IPR001356	Homeobox domain
SuperFamily	SSF46689	5.56E-17	90	159	IPR009057	Homeodomain-like
SMART	SM00389	1.5E-11	91	156	IPR001356	Homeobox domain
Gene3D	G3DSA:1.10.10.60	6.2E-26	94	154	IPR009057	Homeodomain-like
CDD	cd00086	2.65E-10	101	153	No hit	No description
Pfam	PF05920	7.1E-17	109	148	IPR008422	Homeobox KN domain
PROSITE pattern	PS00027	0	127	150	IPR017970	Homeobox, conserved site

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 184 aa Download sequence Send to blast
MAEKEVKMSH VVSAEHWAHV RRTTYLWARS KEAQKENVGD SWSSEEHGDA CGRGRALAED 60 RQRAMGRELK SDLLKRYGEH LCSLKQELSK KKTKKSKLPK EARQKLLIWW ELHYSWPYPS 120 ESEKAALVAS TGLTQNQISN WFINQRKRHW KPSEDARSAV GQGLPLPTAV QFYLADGPSQ 180 AGL*

Functional Description ? help Back to Top
Source	Description
UniProt	May play a role in meristem function, and may be involved in maintaining cells in an undifferentiated, meristematic state, and its expression disappears at the same time the shoot apex undergoes the transition from vegetative to reproductive development (PubMed:11934861). Positive regulator of LATERAL ORGAN BOUNDARIES (LOB) (PubMed:11934861). Probably binds to the DNA sequence 5'-TGAC-3' (PubMed:11934861). Able to traffic from the L1 to the L2/L3 layers of the meristem, presumably through plasmodesmata (PubMed:12900451). {ECO:0000269\|PubMed:11934861, ECO:0000269\|PubMed:12900451, ECO:0000269\|PubMed:7866029}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Negatively regulated by ASYMMETRIC LEAVES1 (AS1) and ASYMMETRIC LEAVES2 (AS2).

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_013465932.1	3e-41	homeotic protein knotted-1
Refseq	XP_015572849.1	1e-41	homeotic protein knotted-1
Swissprot	P46639	1e-41	KNAT1_ARATH; Homeobox protein knotted-1-like 1
TrEMBL	A0A218WE19	9e-41	A0A218WE19_PUNGR; Uncharacterized protein
TrEMBL	A0A443N652	1e-40	A0A443N652_9MAGN; Homeobox protein knotted-1-like protein 2
TrEMBL	A0A4D9BBU7	2e-40	A0A4D9BBU7_SALSN; Uncharacterized protein
TrEMBL	A5Y4G7	2e-40	A5Y4G7_MEDTR; Class I KNOX homeobox transcription factor (Fragment)
TrEMBL	H9CW64	1e-40	H9CW64_ARATH; KNAT1/BP transcription factor splice variant
STRING	EOY15624	6e-40	(Theobroma cacao)
STRING	AT4G08150.1	6e-40	(Arabidopsis thaliana)
STRING	XP_002510027.1	4e-41	(Ricinus communis)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G08150.1	7e-38	KNOTTED-like from Arabidopsis thaliana

Link Out ? help Back to Top
Phytozome	Spipo3G0109000

Publications ? help Back to Top
dela Paz JS, et al. Chromosome fragile sites in Arabidopsis harbor matrix attachment regions that may be associated with ancestral chromosome rearrangement events. PLoS Genet., 2012. 8(12): p. e1003136 [PMID:23284301] Liu C, et al. Phosphatidylserine synthase 1 is required for inflorescence meristem and organ development in Arabidopsis. J Integr Plant Biol, 2013. 55(8): p. 682-95 [PMID:23931744] Liu B, et al. NEVERSHED and INFLORESCENCE DEFICIENT IN ABSCISSION are differentially required for cell expansion and cell separation during floral organ abscission in Arabidopsis thaliana. J. Exp. Bot., 2013. 64(17): p. 5345-57 [PMID:23963677] Simonini S,Kater MM Class I BASIC PENTACYSTEINE factors regulate HOMEOBOX genes involved in meristem size maintenance. J. Exp. Bot., 2014. 65(6): p. 1455-65 [PMID:24482368] Scofield S,Dewitte W,Murray JA STM sustains stem cell function in the Arabidopsis shoot apical meristem and controls KNOX gene expression independently of the transcriptional repressor AS1. Plant Signal Behav, 2018. [PMID:24776954] Lee JE,Lampugnani ER,Bacic A,Golz JF SEUSS and SEUSS-LIKE 2 coordinate auxin distribution and KNOXI activity during embryogenesis. Plant J., 2014. 80(1): p. 122-35 [PMID:25060324] Rast-Somssich MI, et al. Alternate wiring of a KNOXI genetic network underlies differences in leaf development of A. thaliana and C. hirsuta. Genes Dev., 2015. 29(22): p. 2391-404 [PMID:26588991] Duplat-Bermúdez L,Ruiz-Medrano R,Landsman D,Mariño-Ramírez L,Xoconostle-Cázares B Transcriptomic analysis of Arabidopsis overexpressing flowering locus T driven by a meristem-specific promoter that induces early flowering. Gene, 2016. 587(2): p. 120-31 [PMID:27154816] Li Z, et al. Transcription factors AS1 and AS2 interact with LHP1 to repress KNOX genes in Arabidopsis. J Integr Plant Biol, 2016. 58(12): p. 959-970 [PMID:27273574] Lozano-Sotomayor P, et al. Altered expression of the bZIP transcription factor DRINK ME affects growth and reproductive development in Arabidopsis thaliana. Plant J., 2016. 88(3): p. 437-451 [PMID:27402171] Frangedakis E,Saint-Marcoux D,Moody LA,Rabbinowitsch E,Langdale JA Nonreciprocal complementation of KNOX gene function in land plants. New Phytol., 2017. 216(2): p. 591-604 [PMID:27886385] Woerlen N, et al. Repression of BLADE-ON-PETIOLE genes by KNOX homeodomain protein BREVIPEDICELLUS is essential for differentiation of secondary xylem in Arabidopsis root. Planta, 2017. 245(6): p. 1079-1090 [PMID:28204875] Douglas SJ,Li B,Kliebenstein DJ,Nambara E,Riggs CD A novel Filamentous Flower mutant suppresses brevipedicellus developmental defects and modulates glucosinolate and auxin levels. PLoS ONE, 2017. 12(5): p. e0177045 [PMID:28493925] Wang X, et al. Overexpressed BRH1, a RING finger gene, alters rosette leaf shape in Arabidopsis thaliana. Sci China Life Sci, 2018. 61(1): p. 79-87 [PMID:28887625] Simonini S,Stephenson P,Østergaard L A molecular framework controlling style morphology in Brassicaceae. Development, 2018. [PMID:29440299] Felipo-Benavent A, et al. Regulation of xylem fiber differentiation by gibberellins through DELLA-KNAT1 interaction. Development, 2019. [PMID:30389856]