PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Spipo4G0055000

Organism

Spirodela polyrhiza

Taxonomic ID

29656

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela

Family

M-type_MADS

Protein Properties

Length: 97aa MW: 10962.2 Da PI: 11.5912

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Spipo4G0055000	genome	MIPS/IBIS	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	77.8	7.8e-25	10	58	2	50
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50 ri++ +r v+fskRr g+lKKA EL vLCdaevav++fs++gkl + Spipo4G0055000 10 RIDDAARRMVSFSKRRSGLLKKARELAVLCDAEVAVVVFSPKGKLSLFT 58 8********************************************8775 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50066	27.123	1	61	IPR002100	Transcription factor, MADS-box
SMART	SM00432	2.2E-31	1	60	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	4.45E-25	3	64	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	7.4E-24	3	23	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	1.7E-23	10	55	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	7.4E-24	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	7.4E-24	38	59	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 97 aa Download sequence Send to blast
MVRGKVKLQR IDDAARRMVS FSKRRSGLLK KARELAVLCD AEVAVVVFSP KGKLSLFTSQ 60 SRYALTLPHS SFLRFLLVVE CKLMYRLHRE VAGKRP*

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional activator that regulates root development by controlling meristem size and patterning of the root apical meristem. Regulates auxin transport and gradients in the root meristematic cells via direct regulation of the auxin efflux carrier PIN1 and PIN4 gene expression. Binds specifically to the CArG-box DNA sequences in the promoter regions of PIN1 and PIN4 genes (PubMed:24121311). Involved in the regulation of shoot apical meristem (SAM) cell identities and transitions. Promotes flowering transition and participates in flower meristem maintenance and determinacy. Positively regulates TFL1 and WUS expression. Binds directly to the TFL1 regulatory sequences (PubMed:25636918). {ECO:0000269\|PubMed:24121311}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By auxin. {ECO:0000269\|PubMed:24121311}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_022858139.1	7e-23	MADS-box protein SOC1-like isoform X1
Refseq	XP_022858140.1	5e-23	MADS-box protein SOC1-like isoform X2
Swissprot	Q38838	1e-21	AGL14_ARATH; Agamous-like MADS-box protein AGL14
TrEMBL	A0A1D1XXJ4	3e-24	A0A1D1XXJ4_9ARAE; MADS-box transcription factor 56
STRING	Pavir.Bb00065.1.p	3e-24	(Panicum virgatum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP129	38	398

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G11880.1	4e-24	AGAMOUS-like 14

Link Out ? help Back to Top
Phytozome	Spipo4G0055000

Publications ? help Back to Top
Zimmermann P,Hirsch-Hoffmann M,Hennig L,Gruissem W GENEVESTIGATOR. Arabidopsis microarray database and analysis toolbox. Plant Physiol., 2004. 136(1): p. 2621-32 [PMID:15375207] Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Qu Y, et al. Peroxisomal CuAOζ and its product H2O2 regulate the distribution of auxin and IBA-dependent lateral root development in Arabidopsis. J. Exp. Bot., 2017. 68(17): p. 4851-4867 [PMID:28992128]