PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Spipo6G0050000

Organism

Spirodela polyrhiza

Taxonomic ID

29656

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela

Family

TALE

Protein Properties

Length: 149aa MW: 16708.1 Da PI: 10.4181

Description

TALE family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Spipo6G0050000	genome	MIPS/IBIS	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Homeobox	31.1	4e-10	83	116	22	55
SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS Homeobox 22 nrypsaeereeLAkklgLterqVkvWFqNrRake 55 +yp+ ee+++LA+ +gL+++q+ +WF N+R ++ Spipo6G0050000 83 WPYPTDEEKAKLAEVTGLDQKQINNWFINQRKRH 116 59*****************************985 PP
2	ELK	24.5	6.5e-09	37	56	2	21
ELK 2 LKhqLlrKYsgyLgsLkqEF 21 LK+ L++KYs yL++L++E+ Spipo6G0050000 37 LKETLMKKYSNYLSNLRKEL 56 9******************6 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM01188	0.0016	36	57	IPR005539	ELK domain
PROSITE profile	PS51213	9.708	36	56	IPR005539	ELK domain
Pfam	PF03789	2.2E-5	37	56	IPR005539	ELK domain
PROSITE profile	PS50071	12.568	56	119	IPR001356	Homeobox domain
SuperFamily	SSF46689	3.25E-19	58	126	IPR009057	Homeodomain-like
SMART	SM00389	8.5E-12	58	123	IPR001356	Homeobox domain
CDD	cd00086	3.12E-12	60	120	No hit	No description
Gene3D	G3DSA:1.10.10.60	8.4E-28	61	120	IPR009057	Homeodomain-like
Pfam	PF05920	5.3E-18	76	115	IPR008422	Homeobox KN domain
PROSITE pattern	PS00027	0	94	117	IPR017970	Homeobox, conserved site

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 149 aa Download sequence Send to blast
MAGRAAKGVG DASEEKLNCT DPTKKGGGGI WTGGQHLKET LMKKYSNYLS NLRKELQKNR 60 KKGNLPKGAR ALLMDWWTKH YQWPYPTDEE KAKLAEVTGL DQKQINNWFI NQRKRHWKPS 120 EGMRSTLVDG ITGGSHSTTW CFGMALGQ*

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor that may be involved in shoot formation during embryogenesis. {ECO:0000269\|PubMed:10080693}.
UniProt	Probable transcription factor that may be involved in shoot formation during embryogenesis. {ECO:0000269\|PubMed:10080693, ECO:0000269\|PubMed:10488233}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_024456722.1	3e-50	homeobox protein knotted-1-like 1 isoform X1
Swissprot	A2Y007	1e-39	KNOSA_ORYSI; Homeobox protein knotted-1-like 10
Swissprot	Q7GDL5	1e-39	KNOSA_ORYSJ; Homeobox protein knotted-1-like 10
TrEMBL	A0A1D1Z1V5	1e-50	A0A1D1Z1V5_9ARAE; Homeobox protein knotted-1-like 1
STRING	POPTR_0005s01720.1	3e-49	(Populus trichocarpa)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP1698	38	92

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G08150.1	4e-37	KNOTTED-like from Arabidopsis thaliana

Link Out ? help Back to Top
Phytozome	Spipo6G0050000

Publications ? help Back to Top
Ito Y,Eiguchi M,Kurata N KNOX homeobox genes are sufficient in maintaining cultured cells in an undifferentiated state in rice. Genesis, 2001. 30(4): p. 231-8 [PMID:11536429] Postma-Haarsma AD, et al. Developmental regulation and downstream effects of the knox class homeobox genes Oskn2 and Oskn3 from rice. Plant Mol. Biol., 2002. 48(4): p. 423-41 [PMID:11908517] Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Kuijt SJ, et al. Different subcellular localization and trafficking properties of KNOX class 1 homeodomain proteins from rice. Plant Mol. Biol., 2004. 55(6): p. 781-96 [PMID:15604716] Cheng CH, et al. A fine physical map of the rice chromosome 5. Mol. Genet. Genomics, 2005. 274(4): p. 337-45 [PMID:16261349] Chu H, et al. A CLE-WOX signalling module regulates root meristem maintenance and vascular tissue development in rice. J. Exp. Bot., 2013. 64(17): p. 5359-69 [PMID:24043854] Kuijt SJ, et al. Interaction between the GROWTH-REGULATING FACTOR and KNOTTED1-LIKE HOMEOBOX families of transcription factors. Plant Physiol., 2014. 164(4): p. 1952-66 [PMID:24532604] Coudert Y, et al. Identification of CROWN ROOTLESS1-regulated genes in rice reveals specific and conserved elements of postembryonic root formation. New Phytol., 2015. 206(1): p. 243-54 [PMID:25442012] Xu Y, et al. OsARID3, an AT-rich Interaction Domain-containing protein, is required for shoot meristem development in rice. Plant J., 2015. 83(5): p. 806-17 [PMID:26121094] Kir G, et al. RNA Interference Knockdown of BRASSINOSTEROID INSENSITIVE1 in Maize Reveals Novel Functions for Brassinosteroid Signaling in Controlling Plant Architecture. Plant Physiol., 2015. 169(1): p. 826-39 [PMID:26162429]