PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Spipo6G0064700

Organism

Spirodela polyrhiza

Taxonomic ID

29656

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela

Family

MYB

Protein Properties

Length: 312aa MW: 35352.4 Da PI: 7.6679

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Spipo6G0064700	genome	MIPS/IBIS	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	43.2	8.9e-14	14	60	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 r +W+ eEde l ++v qlG+ +W+ I++ ++ R + c++rw+k+l Spipo6G0064700 14 RRPWSSEEDEDLTRLVGQLGTSSWNFISAGIP-DRNPRACRHRWLKHL 60 679***************************.***********96 PP
2	Myb_DNA-binding	45.3	2e-14	66	110	1	47
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 r ++T++Ede ++ a++++G++ W++Iar ++ Rt ++ rw++ Spipo6G0064700 66 RRPFTADEDETIIAAHAKYGNR-WAAIARLLP-ARTNVAVVYRWYTT 110 679*****************.*****.**********87 PP
3	Myb_DNA-binding	46.2	1.1e-14	161	206	1	47
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 r +W+ eEde l ++v q+G+++W+ +++ ++ gR+ +c+ rw+k Spipo6G0064700 161 RRPWSSEEDEELTRLVGQHGTNSWNVVSAGIP-GRSNSSCRVRWLKC 206 679***************************.*********996 PP
4	Myb_DNA-binding	49.6	9.1e-16	215	257	3	47
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 ++T++Ed++++ a++++G++ W++Iar ++ gRt+ +k+rw + Spipo6G0064700 215 PFTADEDKIIIAAHAKYGNK-WTAIARLLP-GRTDAKVKNRWSTT 257 89****************.*****.*********875 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF46689	5.74E-26	12	107	IPR009057	Homeodomain-like
SMART	SM00717	9.0E-11	13	62	IPR001005	SANT/Myb domain
PROSITE profile	PS50090	10.801	14	60	IPR017877	Myb-like domain
CDD	cd00167	2.87E-9	16	60	No hit	No description
Gene3D	G3DSA:1.10.10.60	1.8E-19	16	67	IPR009057	Homeodomain-like
Pfam	PF13921	5.5E-13	17	75	No hit	No description
PROSITE profile	PS51294	18.645	61	115	IPR017930	Myb domain
SMART	SM00717	5.7E-13	65	113	IPR001005	SANT/Myb domain
CDD	cd00167	1.52E-9	68	111	No hit	No description
Gene3D	G3DSA:1.10.10.60	2.8E-19	68	114	IPR009057	Homeodomain-like
PROSITE profile	PS51294	13.531	156	207	IPR017930	Myb domain
SuperFamily	SSF46689	8.11E-29	158	254	IPR009057	Homeodomain-like
SMART	SM00717	1.0E-11	160	209	IPR001005	SANT/Myb domain
Pfam	PF00249	4.6E-13	161	206	IPR001005	SANT/Myb domain
CDD	cd00167	6.18E-10	163	205	No hit	No description
Gene3D	G3DSA:1.10.10.60	5.1E-20	163	214	IPR009057	Homeodomain-like
PROSITE profile	PS51294	22.445	208	262	IPR017930	Myb domain
SMART	SM00717	4.7E-13	212	260	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	6.8E-21	215	259	IPR009057	Homeodomain-like
Pfam	PF00249	1.7E-13	215	256	IPR001005	SANT/Myb domain
CDD	cd00167	3.05E-10	215	258	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 312 aa Download sequence Send to blast
MDDAEHEGQH PAIRRPWSSE EDEDLTRLVG QLGTSSWNFI SAGIPDRNPR ACRHRWLKHL 60 QPDVERRPFT ADEDETIIAA HAKYGNRWAA IARLLPARTN VAVVYRWYTT LAREWWTELS 120 DAAAGEPTTS LRIDLQGYEE VPVAGGGGDQ RENERRDRII RRPWSSEEDE ELTRLVGQHG 180 TNSWNVVSAG IPGRSNSSCR VRWLKCLSPD VEHRPFTADE DKIIIAAHAK YGNKWTAIAR 240 LLPGRTDAKV KNRWSTTLAW NRTEFDATGS KPTTSLPIRL PRDEEPPVAG SRGGDKRGNE 300 EMEAYLMSRR R*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1h88_C	3e-27	13	258	9	158	MYB PROTO-ONCOGENE PROTEIN
1h89_C	3e-27	13	258	9	158	MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor (PubMed:23067202, PubMed:23603962). Represses the expression of protein phosphatases 2C in response to abscisic acid (ABA). Confers resistance to abiotic stresses dependent of ABA (PubMed:18162593, PubMed:9678577). In response to auxin, activates the transcription of the auxin-responsive gene IAA19. The IAA19 transcription activation by MYB44 is enhanced by direct interaction between MYB44 and PYL8 (PubMed:24894996). Transcriptional activator of WRKY70 by direct binding to its promoter region, especially at 5'-TAACNG-3' and 5'-CNGTTA-3' symmetric motifs (PubMed:23067202, PubMed:23603962). Activates salicylic acid (SA)- mediated defenses and subsequent resistance to biotrophic pathogen P.syringae pv. tomato DC3000, but represses jasmonic acid (JA)-mediated defenses responses against the necrotrophic pathogen A.brassicicola (PubMed:23067202). {ECO:0000269\|PubMed:18162593, ECO:0000269\|PubMed:23067202, ECO:0000269\|PubMed:23603962, ECO:0000269\|PubMed:24894996, ECO:0000269\|PubMed:9678577}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By drought, cold, high salinity, cadmium (CdCl(2)), salicylic acid (SA), jasmonate (JA), ethylene, gibberellic acid (GA), and ABA (PubMed:16463103, PubMed:18162593, PubMed:23067202). The induction by JA is COI1-dependent (PubMed:23067202). {ECO:0000269\|PubMed:16463103, ECO:0000269\|PubMed:18162593, ECO:0000269\|PubMed:23067202}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_010937896.2	2e-38	transcription factor MYB77
Refseq	XP_022036380.1	1e-38	transcription factor MYB44-like
Swissprot	Q9FDW1	1e-35	MYB44_ARATH; Transcription factor MYB44
STRING	Gorai.012G149000.1	1e-37	(Gossypium raimondii)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G67300.1	2e-37	myb domain protein r1

Link Out ? help Back to Top
Phytozome	Spipo6G0064700

Publications ? help Back to Top
Li C,Chang PP,Ghebremariam KM,Qin L,Liang Y Overexpression of tomato SpMPK3 gene in Arabidopsis enhances the osmotic tolerance. Biochem. Biophys. Res. Commun., 2014. 443(2): p. 357-62 [PMID:24275141] Jaradat MR,Feurtado JA,Huang D,Lu Y,Cutler AJ Multiple roles of the transcription factor AtMYBR1/AtMYB44 in ABA signaling, stress responses, and leaf senescence. BMC Plant Biol., 2013. 13: p. 192 [PMID:24286353] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Li D, et al. Arabidopsis ABA receptor RCAR1/PYL9 interacts with an R2R3-type MYB transcription factor, AtMYB44. Int J Mol Sci, 2014. 15(5): p. 8473-90 [PMID:24828206] Xu DB, et al. A G-protein β subunit, AGB1, negatively regulates the ABA response and drought tolerance by down-regulating AtMPK6-related pathway in Arabidopsis. PLoS ONE, 2015. 10(1): p. e0116385 [PMID:25635681] Hieno A, et al. Possible Involvement of MYB44-Mediated Stomatal Regulation in Systemic Resistance Induced by Penicillium simplicissimum GP17-2 in Arabidopsis. Microbes Environ., 2016. 31(2): p. 154-9 [PMID:27301421] Zhao Q, et al. AtMYB44 Positively Regulates the Enhanced Elongation of Primary Roots Induced by N-3-Oxo-Hexanoyl-Homoserine Lactone in Arabidopsis thaliana. Mol. Plant Microbe Interact., 2016. 29(10): p. 774-785 [PMID:27604593] Song L, et al. A transcription factor hierarchy defines an environmental stress response network. Science, 2017. [PMID:27811239] Nguyen NH,Cheong JJ H2A.Z-containing nucleosomes are evicted to activate AtMYB44 transcription in response to salt stress. Biochem. Biophys. Res. Commun., 2018. 499(4): p. 1039-1043 [PMID:29649476] Nguyen NH,Cheong JJ AtMYB44 interacts with TOPLESS-RELATED corepressors to suppress protein phosphatase 2C gene transcription. Biochem. Biophys. Res. Commun., 2018. 507(1-4): p. 437-442 [PMID:30448055]