![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Spipo9G0018900 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
|
||||||||
| Family | WRKY | ||||||||
| Protein Properties | Length: 105aa MW: 11333.8 Da PI: 9.9554 | ||||||||
| Description | WRKY family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | WRKY | 106.6 | 1.2e-33 | 23 | 80 | 1 | 58 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS CS
WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnh 58
ldDgy+WrKYGqK+vkg+++prsYY+Cts+gC+++k++ers+ d +vv++tYe +Hnh
Spipo9G0018900 23 LDDGYRWRKYGQKVVKGNPNPRSYYKCTSPGCNARKHIERSSADRNVVITTYERKHNH 80
59******************************************************** PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:2.20.25.80 | 1.1E-36 | 9 | 83 | IPR003657 | WRKY domain |
| SuperFamily | SSF118290 | 1.2E-29 | 15 | 83 | IPR003657 | WRKY domain |
| PROSITE profile | PS50811 | 36.173 | 18 | 83 | IPR003657 | WRKY domain |
| SMART | SM00774 | 1.3E-36 | 23 | 82 | IPR003657 | WRKY domain |
| Pfam | PF03106 | 3.6E-26 | 24 | 80 | IPR003657 | WRKY domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 105 aa Download sequence Send to blast |
MSKVAVPVEP KIIVQTTSEV DLLDDGYRWR KYGQKVVKGN PNPRSYYKCT SPGCNARKHI 60 ERSSADRNVV ITTYERKHNH GVPGARTGGH GQVTDAAAAA AEGL* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1wj2_A | 9e-38 | 14 | 83 | 8 | 77 | Probable WRKY transcription factor 4 |
| 2lex_A | 9e-38 | 14 | 83 | 8 | 77 | Probable WRKY transcription factor 4 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: By salicylic acid and during leaf senescence. {ECO:0000269|PubMed:11449049, ECO:0000269|PubMed:11722756}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_022725732.1 | 2e-43 | probable WRKY transcription factor 3 | ||||
| Swissprot | Q9ZQ70 | 5e-41 | WRKY3_ARATH; Probable WRKY transcription factor 3 | ||||
| TrEMBL | A0A2P5E231 | 6e-44 | A0A2P5E231_PARAD; WRKY domain containing protein | ||||
| TrEMBL | Q6IEQ1 | 2e-43 | Q6IEQ1_ORYSJ; WRKY transcription factor 30 | ||||
| STRING | Gorai.012G186000.1 | 1e-42 | (Gossypium raimondii) | ||||
| STRING | XP_010044462.1 | 3e-42 | (Eucalyptus grandis) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP1345 | 38 | 122 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G03340.1 | 2e-43 | WRKY DNA-binding protein 3 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Spipo9G0018900 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




