PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

TRAES3BF020100120CFD_t1

Common Name

TRAES_3BF020100120CFD_c1

Organism

Triticum aestivum

Taxonomic ID

4565

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum

Family

NAC

Protein Properties

Length: 213aa MW: 23506.7 Da PI: 9.0937

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
TRAES3BF020100120CFD_t1	genome	IWGSC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	174.7	2.6e-54	4	133	1	129
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkat 86 lppGfrFhPtdee+++ yL++k+ + +++ ++i evd++k ePw+Lp+k+k +e+ewyf++++d+ky+tg r+nratk+gyWkat TRAES3BF020100120CFD_t1 4 LPPGFRFHPTDEEIITSYLAPKILNPAFNA-TAIGEVDLNKNEPWELPNKAKMGENEWYFYCQKDRKYPTGIRTNRATKAGYWKAT 88 79***********************999.88***********99999***************************** PP NAM 87 gkdkevlsk..kgelvglkktLvfykgrapkgektdWvmheyrle 129 gkdke+++ + l+g+kktLvfykgrap+gekt+Wvmheyrle TRAES3BF020100120CFD_t1 89 GKDKEIVNPhcMSMLMGMKKTLVFYKGRAPSGEKTNWVMHEYRLE 133 ****9777788**************************85 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	4.84E-59	2	168	IPR003441	NAC domain
PROSITE profile	PS51005	57.118	4	167	IPR003441	NAC domain
Pfam	PF02365	2.0E-28	5	132	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 213 aa Download sequence Send to blast
MLELPPGFRF HPTDEEIITS YLAPKILNPA FNATAIGEVD LNKNEPWELP NKAKMGENEW 60 YFYCQKDRKY PTGIRTNRAT KAGYWKATGK DKEIVNPHCM SMLMGMKKTL VFYKGRAPSG 120 EKTNWVMHEY RLEIGKQSTS GLPTTIANAA SNNVSSKEYV VCRIFHKNTG SGVSSMVSHE 180 DVGTGPGNND QGNGGATTTD KILSMSMRTG GAC

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ut4_A	2e-50	2	171	15	169	NO APICAL MERISTEM PROTEIN
1ut4_B	2e-50	2	171	15	169	NO APICAL MERISTEM PROTEIN
1ut7_A	2e-50	2	171	15	169	NO APICAL MERISTEM PROTEIN
1ut7_B	2e-50	2	171	15	169	NO APICAL MERISTEM PROTEIN
3swm_A	2e-50	2	171	18	172	NAC domain-containing protein 19
3swm_B	2e-50	2	171	18	172	NAC domain-containing protein 19
3swm_C	2e-50	2	171	18	172	NAC domain-containing protein 19
3swm_D	2e-50	2	171	18	172	NAC domain-containing protein 19
3swp_A	2e-50	2	171	18	172	NAC domain-containing protein 19
3swp_B	2e-50	2	171	18	172	NAC domain-containing protein 19
3swp_C	2e-50	2	171	18	172	NAC domain-containing protein 19
3swp_D	2e-50	2	171	18	172	NAC domain-containing protein 19
4dul_A	2e-50	2	171	15	169	NAC domain-containing protein 19
4dul_B	2e-50	2	171	15	169	NAC domain-containing protein 19
Search in ModeBase

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Repressed post-transcriptionally by miR164. {ECO:0000269\|PubMed:15294871, ECO:0000269\|PubMed:17098808, ECO:0000269\|PubMed:18305205, ECO:0000305\|PubMed:15723790}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	HE996626	0.0	HE996626.1 Triticum aestivum cv. Arina SNP, chromosome 3B, clone Taes_arina_ctg_60191.
GenBank	HG670306	0.0	HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020191194.1	1e-143	NAC domain-containing protein 100-like
Swissprot	Q9FLR3	7e-78	NAC79_ARATH; NAC domain-containing protein 79
TrEMBL	W5D096	1e-159	W5D096_WHEAT; Uncharacterized protein
STRING	Traes_3B_9A0FAE972.1	1e-160	(Triticum aestivum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP1452	37	121

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G07680.2	2e-80	NAC domain containing protein 80

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Brenchley R, et al. Analysis of the bread wheat genome using whole-genome shotgun sequencing. Nature, 2012. 491(7426): p. 705-10 [PMID:23192148] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Vidal EA,Álvarez JM,Gutiérrez RA Nitrate regulation of AFB3 and NAC4 gene expression in Arabidopsis roots depends on NRT1.1 nitrate transport function. Plant Signal Behav, 2014. 9(3): p. e28501 [PMID:24642706] Lee MH,Jeon HS,Kim HG,Park OK An Arabidopsis NAC transcription factor NAC4 promotes pathogen-induced cell death under negative regulation by microRNA164. New Phytol., 2017. 214(1): p. 343-360 [PMID:28032643]