![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | TRAES3BF058700130CFD_t1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
| Family | MYB | ||||||||
| Protein Properties | Length: 116aa MW: 13270.2 Da PI: 10.068 | ||||||||
| Description | MYB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 52.5 | 1.2e-16 | 14 | 62 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
rg+W++eEdell +v+ +G +W + +++ g++R++k+c++rw++yl
TRAES3BF058700130CFD_t1 14 RGPWSPEEDELLRSYVRSHGAVsNWIALPQKAGLNRCGKSCRLRWLNYL 62
89******************88**************************7 PP
| |||||||
| 2 | Myb_DNA-binding | 36.7 | 1e-11 | 71 | 111 | 4 | 46 |
S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
Myb_DNA-binding 4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
T++Ed + + + G++ W+ Ia++++ gRt++++k++w++
TRAES3BF058700130CFD_t1 71 YTEQEDMVICSLYNSIGSR-WSIIASKLP-GRTDNDVKNYWNT 111
69*****************.*********.***********97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 21.277 | 9 | 66 | IPR017930 | Myb domain |
| SuperFamily | SSF46689 | 1.92E-27 | 11 | 109 | IPR009057 | Homeodomain-like |
| SMART | SM00717 | 5.4E-11 | 13 | 64 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 1.7E-15 | 14 | 62 | IPR001005 | SANT/Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 7.5E-25 | 15 | 69 | IPR009057 | Homeodomain-like |
| CDD | cd00167 | 1.67E-8 | 16 | 62 | No hit | No description |
| PROSITE profile | PS51294 | 13.141 | 67 | 116 | IPR017930 | Myb domain |
| SMART | SM00717 | 2.5E-10 | 67 | 115 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 2.2E-10 | 69 | 111 | IPR001005 | SANT/Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 7.6E-22 | 70 | 116 | IPR009057 | Homeodomain-like |
| CDD | cd00167 | 3.31E-7 | 71 | 113 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 116 aa Download sequence Send to blast |
MGRAPCCDKA SVKRGPWSPE EDELLRSYVR SHGAVSNWIA LPQKAGLNRC GKSCRLRWLN 60 YLRPDIKHGG YTEQEDMVIC SLYNSIGSRW SIIASKLPGR TDNDVKNYWN TKLKKK |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1a5j_A | 1e-25 | 14 | 116 | 7 | 107 | B-MYB |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription activator (By similarity). Positively regulates axillary meristems (AMs) formation and development, especially during inflorescence. {ECO:0000250, ECO:0000269|PubMed:16461581}. | |||||
| UniProt | Transcription factor that functions as regulator of genes affecting cell wall organization and remodeling. Activates genes related to the primary cell wall and represses genes related to the secondary cell wall and expansins. Required for the regulation of longitudinal cell growth in stems, leaves, petioles, roots, flowers and siliques. {ECO:0000269|PubMed:24563287}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AK108452 | 1e-128 | AK108452.1 Oryza sativa Japonica Group cDNA clone:002-143-C10, full insert sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020179126.1 | 3e-82 | myb-related protein Myb4-like | ||||
| Swissprot | F4JSU0 | 1e-65 | MYB87_ARATH; Transcription factor MYB87 | ||||
| Swissprot | Q9M2Y9 | 1e-65 | RAX3_ARATH; Transcription factor RAX3 | ||||
| TrEMBL | A0A3B6FNK7 | 8e-82 | A0A3B6FNK7_WHEAT; Uncharacterized protein | ||||
| TrEMBL | A0A446PXT5 | 8e-82 | A0A446PXT5_TRITD; Uncharacterized protein | ||||
| STRING | Traes_3B_3D67D3661.1 | 1e-82 | (Triticum aestivum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP135 | 38 | 412 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G49690.1 | 4e-68 | myb domain protein 84 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




