![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | TRAES3BF070300020CFD_t1 | ||||||||
| Common Name | TRAES_3BF070300020CFD_c1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
| Family | ZF-HD | ||||||||
| Protein Properties | Length: 96aa MW: 10561.7 Da PI: 7.0129 | ||||||||
| Description | ZF-HD family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | ZF-HD_dimer | 88.4 | 7.1e-28 | 22 | 78 | 3 | 60 |
ZF-HD_dimer 3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60
vrY+eC++NhA+ +G +avDGC+Ef+ g + +aa l CaACgCHRnFHRrev++e
TRAES3BF070300020CFD_t1 22 YVRYRECQRNHAIGIGRYAVDGCQEFTVLMGVD-EAAMLLCAACGCHRNFHRREVVNE 78
589*************************97776.9999****************9875 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF04770 | 7.7E-26 | 23 | 75 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| ProDom | PD125774 | 3.0E-14 | 23 | 86 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| TIGRFAMs | TIGR01566 | 6.7E-23 | 24 | 75 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| PROSITE profile | PS51523 | 21.303 | 25 | 74 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 96 aa Download sequence Send to blast |
MGSRQDQPAV NGEQGNGAGA AYVRYRECQR NHAIGIGRYA VDGCQEFTVL MGVDEAAMLL 60 CAACGCHRNF HRREVVNEFG ADYHAPRTPP ANENRH |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Inhibits zinc finger homeodomain (ZHD) transcription factors by interacting with them to prevent both their nuclear localization and their DNA-binding properties. Involved in integrating signals from multiple hormones by regulating the expression of specific genes. Promotes the formation of ectopic shoot meristems on leaf margins. {ECO:0000269|PubMed:21455630}. | |||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | HG670306 | 1e-162 | HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020180776.1 | 4e-64 | mini zinc finger protein 3-like | ||||
| Swissprot | Q2Q493 | 2e-19 | MIF3_ARATH; Mini zinc finger protein 3 | ||||
| TrEMBL | A0A077S7E0 | 9e-65 | A0A077S7E0_WHEAT; Uncharacterized protein | ||||
| TrEMBL | A0A446QBY3 | 9e-65 | A0A446QBY3_TRITD; Uncharacterized protein | ||||
| STRING | Traes_3B_5DD53A245.1 | 5e-66 | (Triticum aestivum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP1431 | 34 | 120 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G18835.1 | 1e-21 | mini zinc finger | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




