![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | TRIUR3_01793-P1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
| Family | YABBY | ||||||||
| Protein Properties | Length: 71aa MW: 7275.77 Da PI: 8.3823 | ||||||||
| Description | YABBY family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | YABBY | 57 | 8.4e-18 | 13 | 57 | 7 | 51 |
YABBY 7 seqvCyvqCnfCntilavsvPstslfkvvtvrCGhCtsllsvnla 51
e++ yvqC fC til+vsvP + l+k+v+v+CG+C+ +lsv++a
TRIUR3_01793-P1 13 DERLGYVQCRFCATILLVSVPCSGLLKMVAVQCGCCAGVLSVSVA 57
6899**************************************986 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF04690 | 7.5E-17 | 13 | 57 | IPR006780 | YABBY protein |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0007275 | Biological Process | multicellular organism development | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 71 aa Download sequence Send to blast |
MSSSAPRPAL GLDERLGYVQ CRFCATILLV SVPCSGLLKM VAVQCGCCAG VLSVSVASPP 60 PPPPPQPLLP K |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020166499.1 | 4e-23 | protein YABBY 7-like | ||||
| Swissprot | A2PZN8 | 2e-17 | YAB7_ORYSJ; Protein YABBY 7 | ||||
| TrEMBL | M7ZLS4 | 3e-40 | M7ZLS4_TRIUA; Uncharacterized protein | ||||
| STRING | TRIUR3_01793-P1 | 4e-41 | (Triticum urartu) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP13625 | 28 | 31 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G45190.1 | 1e-10 | YABBY family protein | ||||




