![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | TRIUR3_05688-P1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 102aa MW: 11343.5 Da PI: 4.6764 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 40.1 | 8.5e-13 | 6 | 65 | 37 | 96 |
NF-YB 37 ecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelege 96
e + fi ++++ a+d c+ kr+tin++d++ al ++ f ++vepl++ l+++r +++
TRIUR3_05688-P1 6 ESARIFIHYLSATANDVCKDGKRQTINAEDVFKALDEIEFPEFVEPLRTALEEFRSRNAA 65
66778**************************************************87765 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF47113 | 1.29E-20 | 3 | 97 | IPR009072 | Histone-fold |
| Gene3D | G3DSA:1.10.20.10 | 2.2E-25 | 3 | 95 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 1.5E-6 | 4 | 40 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 102 aa Download sequence Send to blast |
MAAFAESARI FIHYLSATAN DVCKDGKRQT INAEDVFKAL DEIEFPEFVE PLRTALEEFR 60 SRNAARKPAS GKKQSENKRK LDKEAVPEEQ NGAADEANAG ED |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AK371068 | 1e-122 | AK371068.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2124A02. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020188630.1 | 6e-60 | neurofilament heavy polypeptide-like isoform X1 | ||||
| Refseq | XP_020188631.1 | 4e-60 | DNA polymerase epsilon subunit 3-like isoform X2 | ||||
| TrEMBL | A0A3B6HXJ7 | 3e-66 | A0A3B6HXJ7_WHEAT; Uncharacterized protein | ||||
| TrEMBL | A0A446RB99 | 3e-66 | A0A446RB99_TRITD; Uncharacterized protein | ||||
| TrEMBL | M7Z898 | 5e-67 | M7Z898_TRIUA; DNA polymerase epsilon subunit 3 | ||||
| STRING | Traes_4AL_6566FA47B.1 | 5e-67 | (Triticum aestivum) | ||||
| STRING | TRIUR3_05688-P1 | 8e-68 | (Triticum urartu) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP10414 | 37 | 44 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G27470.1 | 3e-27 | nuclear factor Y, subunit B11 | ||||




