![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | TRIUR3_10842-P1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 76aa MW: 8862.01 Da PI: 7.806 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 30.8 | 7e-10 | 31 | 70 | 4 | 45 |
S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
Myb_DNA-binding 4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
+T+ E++l + +++ G++ W++Ia +++ gRt++++ +w
TRIUR3_10842-P1 31 FTEAEEDLVFRMHRLVGNR-WELIAGRIP-GRTAEEVEMFWA 70
9******************.*********.*******99886 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00717 | 1.8E-7 | 27 | 75 | IPR001005 | SANT/Myb domain |
| SuperFamily | SSF46689 | 5.23E-9 | 30 | 72 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS50090 | 6.655 | 31 | 73 | IPR017877 | Myb-like domain |
| CDD | cd00167 | 1.93E-7 | 31 | 69 | No hit | No description |
| Pfam | PF00249 | 6.1E-9 | 31 | 70 | IPR001005 | SANT/Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 4.6E-12 | 31 | 71 | IPR009057 | Homeodomain-like |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0045892 | Biological Process | negative regulation of transcription, DNA-templated | ||||
| GO:1900033 | Biological Process | negative regulation of trichome patterning | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 76 aa Download sequence Send to blast |
MSSESLGKNS KIMGGRERKE VNSTAKHFVD FTEAEEDLVF RMHRLVGNRW ELIAGRIPGR 60 TAEEVEMFWA KRHQDQ |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | MYB-type transcription factor involved in trichome cell specification. Acts as a negative regulator of trichome patterning and formation. May function by suppressing the expression of GL3. {ECO:0000269|PubMed:22168948}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | JF951933 | 1e-121 | JF951933.1 Aegilops speltoides clone TaMYB50 MYB-related protein mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020165156.1 | 3e-49 | MYB-like transcription factor TCL2 | ||||
| Refseq | XP_020165157.1 | 3e-49 | MYB-like transcription factor TCL2 | ||||
| Refseq | XP_020172618.1 | 3e-49 | MYB-like transcription factor TCL2 | ||||
| Refseq | XP_020172619.1 | 3e-49 | MYB-like transcription factor TCL2 | ||||
| Swissprot | B3H4X8 | 4e-19 | TCL2_ARATH; MYB-like transcription factor TCL2 | ||||
| TrEMBL | A0A077RXW4 | 8e-49 | A0A077RXW4_WHEAT; Uncharacterized protein | ||||
| TrEMBL | G9DR96 | 8e-49 | G9DR96_AEGSP; MYB-related protein | ||||
| TrEMBL | M7YVH5 | 8e-49 | M7YVH5_TRIUA; Transcription factor TRY | ||||
| STRING | TRIUR3_10842-P1 | 1e-49 | (Triticum urartu) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP5275 | 31 | 57 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G30424.1 | 2e-21 | MYB_related family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




