![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | TRIUR3_13881-P1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
| Family | WRKY | ||||||||
| Protein Properties | Length: 80aa MW: 9087.13 Da PI: 9.1905 | ||||||||
| Description | WRKY family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | WRKY | 46 | 1.1e-14 | 45 | 80 | 2 | 37 |
--SS-EEEEEEE--TT-SS-EEEEEE-STT---EEE CS
WRKY 2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkk 37
+Dgy+W+KYGqK +k+ + rsY+rC ++C +kkk
TRIUR3_13881-P1 45 EDGYQWKKYGQKFIKNIQKIRSYFRCRDKRCGAKKK 80
7*********************************97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50811 | 14.171 | 39 | 80 | IPR003657 | WRKY domain |
| SuperFamily | SSF118290 | 1.44E-14 | 41 | 80 | IPR003657 | WRKY domain |
| Gene3D | G3DSA:2.20.25.80 | 4.0E-15 | 42 | 80 | IPR003657 | WRKY domain |
| SMART | SM00774 | 2.5E-5 | 44 | 80 | IPR003657 | WRKY domain |
| Pfam | PF03106 | 1.7E-12 | 45 | 80 | IPR003657 | WRKY domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 80 aa Download sequence Send to blast |
MASTSQPPTT GSGEGERSHH GDEEDQQQAA WAEEAAGVQP LVMPEDGYQW KKYGQKFIKN 60 IQKIRSYFRC RDKRCGAKKK |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | JQ806389 | 9e-68 | JQ806389.1 Hordeum vulgare WRKY transcript factor 48 (WRKY48) mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020162458.1 | 2e-45 | WRKY transcription factor WRKY24-like isoform X2 | ||||
| Refseq | XP_020181478.1 | 2e-45 | WRKY transcription factor WRKY24-like isoform X2 | ||||
| TrEMBL | T1M8J4 | 4e-53 | T1M8J4_TRIUA; Uncharacterized protein | ||||
| STRING | TRIUR3_13881-P1 | 7e-54 | (Triticum urartu) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP10158 | 34 | 44 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G39410.1 | 3e-11 | WRKY DNA-binding protein 13 | ||||




