PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

TRIUR3_18962-P1

Organism

Triticum urartu

Taxonomic ID

4572

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum

Family

M-type_MADS

Protein Properties

Length: 91aa MW: 10407.2 Da PI: 11.2317

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
TRIUR3_18962-P1	genome	BGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	86.7	1.3e-27	3	52	2	51
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 rie + rqvtfskRr g+lKKA+ELSvLCdaeva+++fs++g+lye++s TRIUR3_18962-P1 3 RIETPRSRQVTFSKRRGGLLKKAFELSVLCDAEVALVVFSPRGRLYEFAS 52 89999*******************************************86 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF55455	3.53E-26	1	74	IPR002100	Transcription factor, MADS-box
SMART	SM00432	3.5E-28	1	53	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	27.081	1	54	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	2.2E-26	3	50	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	3.2E-18	16	31	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	3.2E-18	31	52	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 91 aa Download sequence Send to blast
MRRIETPRSR QVTFSKRRGG LLKKAFELSV LCDAEVALVV FSPRGRLYEF ASSRYFMVLS 60 VGNSHTKIKA NNHYDCRAST IIQIRQIMVV G

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
3kov_A	9e-17	3	59	9	65	Myocyte-specific enhancer factor 2A
3kov_B	9e-17	3	59	9	65	Myocyte-specific enhancer factor 2A
3kov_I	9e-17	3	59	9	65	Myocyte-specific enhancer factor 2A
3kov_J	9e-17	3	59	9	65	Myocyte-specific enhancer factor 2A
3mu6_A	7e-17	3	53	9	59	Myocyte-specific enhancer factor 2A
3mu6_B	7e-17	3	53	9	59	Myocyte-specific enhancer factor 2A
3mu6_C	7e-17	3	53	9	59	Myocyte-specific enhancer factor 2A
3mu6_D	7e-17	3	53	9	59	Myocyte-specific enhancer factor 2A
3p57_A	9e-17	3	59	9	65	Myocyte-specific enhancer factor 2A
3p57_B	9e-17	3	59	9	65	Myocyte-specific enhancer factor 2A
3p57_C	9e-17	3	59	9	65	Myocyte-specific enhancer factor 2A
3p57_D	9e-17	3	59	9	65	Myocyte-specific enhancer factor 2A
3p57_I	9e-17	3	59	9	65	Myocyte-specific enhancer factor 2A
3p57_J	9e-17	3	59	9	65	Myocyte-specific enhancer factor 2A
5f28_A	1e-16	3	59	10	66	MEF2C
5f28_B	1e-16	3	59	10	66	MEF2C
5f28_C	1e-16	3	59	10	66	MEF2C
5f28_D	1e-16	3	59	10	66	MEF2C
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor.
UniProt	Probable transcription factor.
UniProt	Probable transcription factor active in flowering time control. May control internode elongation and promote floral transition phase. May act upstream of the floral regulators MADS1, MADS14, MADS15 and MADS18 in the floral induction pathway. {ECO:0000269\|PubMed:15144377, ECO:0000269\|PubMed:17166135}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AB281427	7e-75	AB281427.1 Triticum aestivum MADS-box mRNA for MADS-box transcription factor, complete cds.
GenBank	AM502887	7e-75	AM502887.1 Triticum aestivum mRNA for MIKC-type MADS-box transcription factor WM21A (WM21A gene).
GenBank	DQ512339	7e-75	DQ512339.1 Triticum aestivum MADS-box transcription factor TaAGL21 (AGL21) mRNA, complete cds.
GenBank	DQ512354	7e-75	DQ512354.1 Triticum aestivum MADS-box transcription factor TaAGL38 (AGL38) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020161221.1	7e-28	MADS-box transcription factor 50-like
Swissprot	A2Z9Q7	8e-27	MAD56_ORYSI; MADS-box transcription factor 56
Swissprot	P0C5B2	7e-27	MAD56_ORYSJ; MADS-box transcription factor 56
Swissprot	Q9XJ60	8e-27	MAD50_ORYSJ; MADS-box transcription factor 50
TrEMBL	M7ZIF7	1e-60	M7ZIF7_TRIUA; MADS-box transcription factor 56
STRING	TRIUR3_18962-P1	2e-61	(Triticum urartu)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP129	38	398

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G22950.1	5e-28	AGAMOUS-like 19

Publications ? help Back to Top
Rice Chromosome 10 Sequencing Consortium In-depth view of structure, activity, and evolution of rice chromosome 10. Science, 2003. 300(5625): p. 1566-9 [PMID:12791992] Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Thomson MJ,Edwards JD,Septiningsih EM,Harrington SE,McCouch SR Substitution mapping of dth1.1, a flowering-time quantitative trait locus (QTL) associated with transgressive variation in rice, reveals multiple sub-QTL. Genetics, 2006. 172(4): p. 2501-14 [PMID:16452146] Park SJ, et al. Rice Indeterminate 1 (OsId1) is necessary for the expression of Ehd1 (Early heading date 1) regardless of photoperiod. Plant J., 2008. 56(6): p. 1018-29 [PMID:18774969] Lee S,Jeong DH,An G A possible working mechanism for rice SVP-group MADS-box proteins as negative regulators of brassinosteroid responses. Plant Signal Behav, 2008. 3(7): p. 471-4 [PMID:19704489] Maas LF,McClung A,McCouch S Dissection of a QTL reveals an adaptive, interacting gene complex associated with transgressive variation for flowering time in rice. Theor. Appl. Genet., 2010. 120(5): p. 895-908 [PMID:19949767] Sun C, et al. The histone methyltransferase SDG724 mediates H3K36me2/3 deposition at MADS50 and RFT1 and promotes flowering in rice. Plant Cell, 2012. 24(8): p. 3235-47 [PMID:22892321] Choi SC, et al. Trithorax group protein Oryza sativa Trithorax1 controls flowering time in rice via interaction with early heading date3. Plant Physiol., 2014. 164(3): p. 1326-37 [PMID:24420930] Núñez-López L,Aguirre-Cruz A,Barrera-Figueroa BE,Peña-Castro JM Improvement of enzymatic saccharification yield in Arabidopsis thaliana by ectopic expression of the rice SUB1A-1 transcription factor. PeerJ, 2015. 3: p. e817 [PMID:25780769] Jin J, et al. MORF-RELATED GENE702, a Reader Protein of Trimethylated Histone H3 Lysine 4 and Histone H3 Lysine 36, Is Involved in Brassinosteroid-Regulated Growth and Flowering Time Control in Rice. Plant Physiol., 2015. 168(4): p. 1275-85 [PMID:25855537] Liu X, et al. Brassinosteroid (BR) biosynthetic gene lhdd10 controls late heading and plant height in rice (Oryza sativa L.). Plant Cell Rep., 2016. 35(2): p. 357-68 [PMID:26518431] Hwang YH, et al. Functional conservation of rice OsNF-YB/YC and Arabidopsis AtNF-YB/YC proteins in the regulation of flowering time. Plant Cell Rep., 2016. 35(4): p. 857-65 [PMID:26754793] Bai Z, et al. The impact and origin of copy number variations in the Oryza species. BMC Genomics, 2016. 17: p. 261 [PMID:27025496] Shibaya T, et al. Hd18, Encoding Histone Acetylase Related to Arabidopsis FLOWERING LOCUS D, is Involved in the Control of Flowering Time in Rice. Plant Cell Physiol., 2016. 57(9): p. 1828-38 [PMID:27318280] Alter P, et al. Flowering Time-Regulated Genes in Maize Include the Transcription Factor ZmMADS1. Plant Physiol., 2016. 172(1): p. 389-404 [PMID:27457125] Han Z,Zhang B,Zhao H,Ayaad M,Xing Y Genome-Wide Association Studies Reveal that Diverse Heading Date Genes Respond to Short and Long Day Lengths between Indica and Japonica Rice. Front Plant Sci, 2016. 7: p. 1270 [PMID:27621738]