PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

TRIUR3_19588-P1

Organism

Triticum urartu

Taxonomic ID

4572

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum

Family

bZIP

Protein Properties

Length: 119aa MW: 13619 Da PI: 4.9404

Description

bZIP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
TRIUR3_19588-P1	genome	BGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	bZIP_1	44.9	2.5e-14	5	56	3	54
XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkk 54 + +r++r++kNRe+A rsR+RK+a+i+eLe v +Le+e +L e ee ++ TRIUR3_19588-P1 5 ATQRQKRMIKNRESAARSRERKQAYIAELEAQVTQLEEEHAELLREQEEQNE 56 679*************************************999988776555 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00338	8.1E-9	2	65	IPR004827	Basic-leucine zipper domain
PROSITE profile	PS50217	10.76	5	57	IPR004827	Basic-leucine zipper domain
Pfam	PF00170	9.4E-13	5	57	IPR004827	Basic-leucine zipper domain
CDD	cd14707	2.18E-16	7	54	No hit	No description
Gene3D	G3DSA:1.20.5.170	1.1E-13	8	56	No hit	No description
SuperFamily	SSF57959	1.5E-11	8	55	No hit	No description
PROSITE pattern	PS00036	0	10	25	IPR004827	Basic-leucine zipper domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 119 aa Download sequence Send to blast
MDRAATQRQK RMIKNRESAA RSRERKQAYI AELEAQVTQL EEEHAELLRE QEEQNEKRLN 60 EANAAGFKAG TGAFLYAPVY EVTATTTTEK EEEKERDRAA AWAGGDALPP PPRRRMEED

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator that binds to the ABA-responsive elements (ABREs) in vitro. Involved in abiotic stress responses and abscisic acid (ABA) signaling (PubMed:20039193). Involved in the signaling pathway that induces growth inhibition in response to D-allose (PubMed:23397192). {ECO:0000269\|PubMed:20039193, ECO:0000269\|PubMed:23397192}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00648	PBM	Transfer from LOC_Os05g36160	Download

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by anoxia, drought, salt stress, oxidative stress, cold and abscisic acid (ABA) (PubMed:20039193). Induced by D-allose (PubMed:23397192). {ECO:0000269\|PubMed:20039193, ECO:0000269\|PubMed:23397192}.

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	KT224373	5e-95	KT224373.1 Triticum aestivum cultivar RAC875 bZIP2 mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_003568373.1	5e-32	bZIP transcription factor 12
Refseq	XP_020178558.1	5e-32	G-box-binding factor 4-like
Swissprot	Q0JHF1	5e-25	BZP12_ORYSJ; bZIP transcription factor 12
TrEMBL	M7YJC4	2e-78	M7YJC4_TRIUA; G-box-binding factor 4
STRING	TRIUR3_19588-P1	3e-79	(Triticum urartu)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP2665	37	86

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G03970.1	6e-13	G-box binding factor 4

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764]