PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

TRIUR3_20925-P1

Organism

Triticum urartu

Taxonomic ID

4572

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum

Family

M-type_MADS

Protein Properties

Length: 105aa MW: 12081 Da PI: 10.7979

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
TRIUR3_20925-P1	genome	BGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	100.4	6.8e-32	10	59	2	51
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 rienk+nrqvtfskRr g+lKKA+E+SvLCdaeva+i+fs++gklyeyss TRIUR3_20925-P1 10 RIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALIVFSTKGKLYEYSS 59 8***********************************************96 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	3.8E-38	1	60	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	32.184	1	61	IPR002100	Transcription factor, MADS-box
CDD	cd00265	2.09E-36	2	61	No hit	No description
SuperFamily	SSF55455	8.37E-30	2	75	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.5E-31	3	23	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	1.7E-26	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.5E-31	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.5E-31	38	59	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 105 aa Download sequence Send to blast
MGRGPVQLRR IENKINRQVT FSKRRSGLLK KAHEISVLCD AEVALIVFST KGKLYEYSSQ 60 DRLWSSILRS FKENNRYTKP ETGQLNGCKV VSLRYPPTLL SSFMN

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5f28_A	1e-21	1	93	1	88	MEF2C
5f28_B	1e-21	1	93	1	88	MEF2C
5f28_C	1e-21	1	93	1	88	MEF2C
5f28_D	1e-21	1	93	1	88	MEF2C
6bz1_A	9e-22	1	94	1	89	MEF2 CHIMERA
6bz1_B	9e-22	1	94	1	89	MEF2 CHIMERA
6bz1_C	9e-22	1	94	1	89	MEF2 CHIMERA
6bz1_D	9e-22	1	94	1	89	MEF2 CHIMERA
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor.
UniProt	Probable transcription factor that may promote floral transition phase and differentiation program of the vegetative shoot. {ECO:0000269\|PubMed:11971906, ECO:0000269\|PubMed:15299121}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	DQ534490	3e-96	DQ534490.1 Triticum aestivum MADS2 mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020200409.1	1e-36	MADS-box transcription factor 18-like isoform X2
Swissprot	A2YNI2	7e-34	MAD18_ORYSI; MADS-box transcription factor 18
Swissprot	Q0D4T4	7e-34	MAD18_ORYSJ; MADS-box transcription factor 18
TrEMBL	M7ZDM0	1e-71	M7ZDM0_TRIUA; MADS-box transcription factor 18
STRING	TRIUR3_20925-P1	2e-72	(Triticum urartu)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP129	38	398

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G60910.1	7e-34	AGAMOUS-like 8

Publications ? help Back to Top
Jia H, et al. Characterization and transcriptional profiles of two rice MADS-box genes. Plant Sci., 2000. 155(2): p. 115-122 [PMID:10814814] Chen C, et al. Adapting rice anther culture to gene transformation and RNA interference. Sci. China, C, Life Sci., 2006. 49(5): p. 414-28 [PMID:17172048] Yoshida H, et al. superwoman1-cleistogamy, a hopeful allele for gene containment in GM rice. Plant Biotechnol. J., 2007. 5(6): p. 835-46 [PMID:17764519] Yao SG,Ohmori S,Kimizu M,Yoshida H Unequal genetic redundancy of rice PISTILLATA orthologs, OsMADS2 and OsMADS4, in lodicule and stamen development. Plant Cell Physiol., 2008. 49(5): p. 853-7 [PMID:18378529] Seok HY, et al. Rice ternary MADS protein complexes containing class B MADS heterodimer. Biochem. Biophys. Res. Commun., 2010. 401(4): p. 598-604 [PMID:20888318] Kobayashi K, et al. Inflorescence meristem identity in rice is specified by overlapping functions of three AP1/FUL-like MADS box genes and PAP2, a SEPALLATA MADS box gene. Plant Cell, 2012. 24(5): p. 1848-59 [PMID:22570445] Wei X, et al. Fine mapping of BH1, a gene controlling lemma and palea development in rice. Plant Cell Rep., 2013. 32(9): p. 1455-63 [PMID:23689259] Wang H, et al. OsMADS32 interacts with PI-like proteins and regulates rice flower development. J Integr Plant Biol, 2015. 57(5): p. 504-13 [PMID:25081486] Lombardo F, et al. The superwoman1-cleistogamy2 mutant is a novel resource for gene containment in rice. Plant Biotechnol. J., 2017. 15(1): p. 97-106 [PMID:27336225]