![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | TRIUR3_21275-P1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
| Family | SBP | ||||||||
| Protein Properties | Length: 84aa MW: 8909.05 Da PI: 11.0727 | ||||||||
| Description | SBP family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SBP | 72.7 | 6.3e-23 | 35 | 83 | 1 | 49 |
--SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSE CS
SBP 1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrf 49
+CqvegC ++l +akeyhr+h+vCe+h+k p v+v+g+e+rfCqqCsr
TRIUR3_21275-P1 35 RCQVEGCGVELRDAKEYHRKHRVCEAHTKFPRVVVAGQERRFCQQCSRL 83
6**********************************************96 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:4.10.1100.10 | 1.5E-24 | 28 | 83 | IPR004333 | Transcription factor, SBP-box |
| PROSITE profile | PS51141 | 20.127 | 33 | 84 | IPR004333 | Transcription factor, SBP-box |
| SuperFamily | SSF103612 | 1.83E-22 | 34 | 83 | IPR004333 | Transcription factor, SBP-box |
| Pfam | PF03110 | 4.6E-18 | 36 | 83 | IPR004333 | Transcription factor, SBP-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 84 aa Download sequence Send to blast |
MGLRQRSGGG GGRDKRARGE AAGGGGGGGG GGGVRCQVEG CGVELRDAKE YHRKHRVCEA 60 HTKFPRVVVA GQERRFCQQC SRLR |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1ul4_A | 5e-15 | 27 | 83 | 1 | 58 | squamosa promoter binding protein-like 4 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May be involved in panicle development. {ECO:0000250}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Negatively regulated by microRNAs miR156b and miR156h. {ECO:0000305|PubMed:16861571}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AK353784 | 1e-63 | AK353784.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, partial cds, clone: NIASHv1002L21. | |||
| GenBank | AK361610 | 1e-63 | AK361610.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1144O20. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020186598.1 | 1e-28 | squamosa promoter-binding-like protein 4 | ||||
| Swissprot | Q6H509 | 5e-26 | SPL4_ORYSJ; Squamosa promoter-binding-like protein 4 | ||||
| TrEMBL | M7Z7I0 | 6e-49 | M7Z7I0_TRIUA; Squamosa promoter-binding-like protein 4 | ||||
| STRING | TRIUR3_21275-P1 | 9e-50 | (Triticum urartu) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP25180 | 5 | 5 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G43270.3 | 2e-23 | squamosa promoter binding protein-like 2 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




