PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

TRIUR3_21876-P1

Organism

Triticum urartu

Taxonomic ID

4572

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum

Family

M-type_MADS

Protein Properties

Length: 283aa MW: 31835.2 Da PI: 10.0273

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
TRIUR3_21876-P1	genome	BGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	101.8	2.6e-32	73	123	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krienk+nrqvtfskRrng+lKKA+E+SvLCdaevavi+fs++gklyey++ TRIUR3_21876-P1 73 KRIENKINRQVTFSKRRNGLLKKAHEISVLCDAEVAVIVFSPKGKLYEYAT 123 79***********************************************86 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF57756	1.43E-9	27	59	IPR001878	Zinc finger, CCHC-type
Gene3D	G3DSA:4.10.60.10	4.4E-9	38	55	IPR001878	Zinc finger, CCHC-type
SMART	SM00343	0.0014	38	54	IPR001878	Zinc finger, CCHC-type
PROSITE profile	PS50158	9.142	39	54	IPR001878	Zinc finger, CCHC-type
Pfam	PF00098	1.1E-4	39	54	IPR001878	Zinc finger, CCHC-type
SMART	SM00432	5.5E-43	65	124	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	33.095	65	125	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	4.84E-35	66	151	IPR002100	Transcription factor, MADS-box
CDD	cd00265	1.54E-44	66	140	No hit	No description
PRINTS	PR00404	8.1E-32	67	87	IPR002100	Transcription factor, MADS-box
PROSITE pattern	PS00350	0	67	121	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	2.4E-27	74	121	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	8.1E-32	87	102	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	8.1E-32	102	123	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0008270	Molecular Function	zinc ion binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 283 aa Download sequence Send to blast
MGILGLQGKG KKGNFKKNGK LVAAQVKKPK SVPKPETECF YCKETGHWKQ NCPKYFADKK 60 DGKDMGRGKV QLKRIENKIN RQVTFSKRRN GLLKKAHEIS VLCDAEVAVI VFSPKGKLYE 120 YATDSSMDKI LERYERYSYA EKALISAESE SESHLMMESI SELQKKERSL QEENKALQKE 180 LVERQKAAAS RQQQQQQQQM QWEHQAQTQT HAHTQNQPQA QTSSSSSSFM MRDQQAHAPQ 240 QNICSYPPVT MGGEAAAAAA APGQQAQLRI GGLPPWMLSH LNA

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
6byy_A	3e-23	65	138	1	73	MEF2 CHIMERA
6byy_B	3e-23	65	138	1	73	MEF2 CHIMERA
6byy_C	3e-23	65	138	1	73	MEF2 CHIMERA
6byy_D	3e-23	65	138	1	73	MEF2 CHIMERA
6bz1_A	4e-23	65	138	1	73	MEF2 CHIMERA
6bz1_B	4e-23	65	138	1	73	MEF2 CHIMERA
6bz1_C	4e-23	65	138	1	73	MEF2 CHIMERA
6bz1_D	4e-23	65	138	1	73	MEF2 CHIMERA
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	DQ512346	0.0	DQ512346.1 Triticum aestivum MADS-box transcription factor TaAGL29 (AGL29) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020149442.1	1e-116	MADS-box transcription factor 15-like
Swissprot	Q6Q9I2	2e-87	MAD15_ORYSJ; MADS-box transcription factor 15
TrEMBL	M7ZU09	0.0	M7ZU09_TRIUA; MADS-box transcription factor 15
STRING	TRIUR3_21876-P1	0.0	(Triticum urartu)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP1151	37	113

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G69120.1	1e-40	MIKC_MADS family protein

Publications ? help Back to Top
Cai Q, et al. [PAEs in composts of municipal sludge and rice straw]. Ying Yong Sheng Tai Xue Bao, 2003. 14(11): p. 1993-6 [PMID:14997664] Wang K, et al. DEP and AFO regulate reproductive habit in rice. PLoS Genet., 2010. 6(1): p. e1000818 [PMID:20107517] Kobayashi K, et al. Inflorescence meristem identity in rice is specified by overlapping functions of three AP1/FUL-like MADS box genes and PAP2, a SEPALLATA MADS box gene. Plant Cell, 2012. 24(5): p. 1848-59 [PMID:22570445] Ramanujam R,Yishi X,Liu H,Naqvi NI Structure-function analysis of Rgs1 in Magnaporthe oryzae: role of DEP domains in subcellular targeting. PLoS ONE, 2012. 7(7): p. e41084 [PMID:22927898] Ang TN,Ngoh GC,Chua AS,Lee MG Elucidation of the effect of ionic liquid pretreatment on rice husk via structural analyses. Biotechnol Biofuels, 2012. 5(1): p. 67 [PMID:22958710] Zhang G,Huang K,Jiang X,Huang D,Yang Y Acetylation of rice straw for thermoplastic applications. Carbohydr Polym, 2013. 96(1): p. 218-26 [PMID:23688473] Wei X, et al. Fine mapping of BH1, a gene controlling lemma and palea development in rice. Plant Cell Rep., 2013. 32(9): p. 1455-63 [PMID:23689259] Hu S, et al. A point mutation in the zinc finger motif of RID1/EHD2/OsID1 protein leads to outstanding yield-related traits in japonica rice variety Wuyunjing 7. Rice (N Y), 2013. 6(1): p. 24 [PMID:24280027] Ji Y, et al. A comprehensive assessment of human exposure to phthalates from environmental media and food in Tianjin, China. J. Hazard. Mater., 2014. 279: p. 133-40 [PMID:25051237] Huang Y, et al. Phthalates in Commercial Chinese Rice Wines: Concentrations and the Cumulative Risk Assessment to Adult Males in Shanghai. Biomed. Environ. Sci., 2014. 27(10): p. 819-23 [PMID:25341819] Tamaki S, et al. FT-like proteins induce transposon silencing in the shoot apex during floral induction in rice. Proc. Natl. Acad. Sci. U.S.A., 2015. 112(8): p. E901-10 [PMID:25675495] Wu F, et al. The ABCs of flower development: mutational analysis of AP1/FUL-like genes in rice provides evidence for a homeotic (A)-function in grasses. Plant J., 2017. 89(2): p. 310-324 [PMID:27689766]