![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | TRIUR3_22964-P1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 113aa MW: 12968 Da PI: 10.783 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 90.4 | 9.3e-29 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
krien++ rqvtfskRrng+lKKA+ELSvLCd+eva+ +f ++g+lye+ss
TRIUR3_22964-P1 9 KRIENETSRQVTFSKRRNGLLKKAFELSVLCDVEVALAVFCPRGRLYEFSS 59
79***********************************************96 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50066 | 29.352 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
| SMART | SM00432 | 1.3E-34 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| SuperFamily | SSF55455 | 1.57E-26 | 3 | 62 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 2.0E-28 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 2.41E-34 | 3 | 59 | No hit | No description |
| Pfam | PF00319 | 1.3E-25 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 2.0E-28 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 2.0E-28 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 113 aa Download sequence Send to blast |
MVRGKTAMKR IENETSRQVT FSKRRNGLLK KAFELSVLCD VEVALAVFCP RGRLYEFSSA 60 TRRAQQLRCG RGRKATATNG EKISCDVRTR TVDRMYLYVW AQSFSTYDLV IFG |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5f28_A | 4e-15 | 1 | 60 | 1 | 60 | MEF2C |
| 5f28_B | 4e-15 | 1 | 60 | 1 | 60 | MEF2C |
| 5f28_C | 4e-15 | 1 | 60 | 1 | 60 | MEF2C |
| 5f28_D | 4e-15 | 1 | 60 | 1 | 60 | MEF2C |
| 6byy_A | 4e-15 | 1 | 60 | 1 | 60 | MEF2 CHIMERA |
| 6byy_B | 4e-15 | 1 | 60 | 1 | 60 | MEF2 CHIMERA |
| 6byy_C | 4e-15 | 1 | 60 | 1 | 60 | MEF2 CHIMERA |
| 6byy_D | 4e-15 | 1 | 60 | 1 | 60 | MEF2 CHIMERA |
| 6bz1_A | 3e-15 | 1 | 60 | 1 | 60 | MEF2 CHIMERA |
| 6bz1_B | 3e-15 | 1 | 60 | 1 | 60 | MEF2 CHIMERA |
| 6bz1_C | 3e-15 | 1 | 60 | 1 | 60 | MEF2 CHIMERA |
| 6bz1_D | 3e-15 | 1 | 60 | 1 | 60 | MEF2 CHIMERA |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor active in flowering time control. May control internode elongation and promote floral transition phase. May act upstream of the floral regulators MADS1, MADS14, MADS15 and MADS18 in the floral induction pathway. {ECO:0000269|PubMed:15144377, ECO:0000269|PubMed:17166135}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AM502862 | 9e-75 | AM502862.1 Triticum aestivum mRNA for MIKC-type MADS-box transcription factor WM1B (WM1B gene). | |||
| GenBank | DQ512363 | 9e-75 | DQ512363.1 Triticum aestivum MADS-box transcription factor TaAGL7 (AGL7) mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020179424.1 | 1e-34 | agamous-like MADS-box protein AGL14 | ||||
| Swissprot | Q9XJ60 | 2e-31 | MAD50_ORYSJ; MADS-box transcription factor 50 | ||||
| TrEMBL | M8B229 | 4e-77 | M8B229_TRIUA; MADS-box transcription factor 50 | ||||
| STRING | TRIUR3_22964-P1 | 6e-78 | (Triticum urartu) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP129 | 38 | 398 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G11880.1 | 2e-33 | AGAMOUS-like 14 | ||||




