![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | TRIUR3_23036-P1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 96aa MW: 11135.8 Da PI: 8.4914 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 54.3 | 3.1e-17 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
+g+WT+eEd++l+ +++ G g+W++ ++ g+ R++k+c++rw +yl
TRIUR3_23036-P1 14 KGAWTKEEDQRLIAYIRANGEGCWRSLPKAAGLLRCGKSCRLRWMNYL 61
79******************************99************97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.10.60 | 1.1E-23 | 5 | 64 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS51294 | 23.268 | 9 | 65 | IPR017930 | Myb domain |
| SMART | SM00717 | 8.0E-13 | 13 | 63 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 1.4E-15 | 14 | 61 | IPR001005 | SANT/Myb domain |
| SuperFamily | SSF46689 | 1.14E-22 | 15 | 88 | IPR009057 | Homeodomain-like |
| CDD | cd00167 | 1.62E-9 | 16 | 61 | No hit | No description |
| Gene3D | G3DSA:1.10.10.60 | 2.6E-10 | 65 | 88 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS51294 | 8.211 | 66 | 96 | IPR017930 | Myb domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 96 aa Download sequence Send to blast |
MGRSPCCEKE HTNKGAWTKE EDQRLIAYIR ANGEGCWRSL PKAAGLLRCG KSCRLRWMNY 60 LRPDLKRGNF TDEEDELIIR LHSLLGNKPL EEGQYI |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1h8a_C | 2e-17 | 13 | 88 | 26 | 100 | MYB TRANSFORMING PROTEIN |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor. {ECO:0000305}. | |||||
| UniProt | Transcription repressor involved in regulation of protection against UV. Mediates transcriptional repression of CYP73A5, the gene encoding trans-cinnamate 4-monooxygenase, thereby regulating the accumulation of the UV-protectant compound sinapoylmalate. {ECO:0000269|PubMed:11080161}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Down-regulated by exposure to UV-B light. {ECO:0000269|PubMed:11080161}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AK368728 | 1e-138 | AK368728.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2078M17. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020151216.1 | 1e-57 | myb-related protein 308-like | ||||
| Swissprot | P81393 | 1e-55 | MYB08_ANTMA; Myb-related protein 308 | ||||
| Swissprot | Q9SZP1 | 3e-55 | MYB4_ARATH; Transcription repressor MYB4 | ||||
| TrEMBL | M7ZLJ0 | 1e-64 | M7ZLJ0_TRIUA; Transcription repressor MYB4 | ||||
| STRING | TRIUR3_23036-P1 | 2e-65 | (Triticum urartu) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP116 | 37 | 448 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G38620.1 | 1e-57 | myb domain protein 4 | ||||




