![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | TRIUR3_23318-P1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
| Family | bZIP | ||||||||
| Protein Properties | Length: 84aa MW: 9603.55 Da PI: 11.3682 | ||||||||
| Description | bZIP family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | bZIP_1 | 47.6 | 3.7e-15 | 10 | 66 | 6 | 62 |
HHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
bZIP_1 6 rerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62
+ r++kNRe+A rsR+RK+a+++eLe++v L + N +Lk + ++l+ e+a+l+++
TRIUR3_23318-P1 10 KSVRAMKNRESALRSRARKRAYTQELEKEVRRLVEDNLKLKRQCKQLQSEIAALTAQ 66
568*************************************************99876 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00338 | 7.6E-12 | 4 | 69 | IPR004827 | Basic-leucine zipper domain |
| PROSITE profile | PS50217 | 10.806 | 7 | 63 | IPR004827 | Basic-leucine zipper domain |
| SuperFamily | SSF57959 | 2.0E-12 | 10 | 65 | No hit | No description |
| Gene3D | G3DSA:1.20.5.170 | 1.1E-14 | 11 | 66 | No hit | No description |
| Pfam | PF00170 | 7.4E-12 | 12 | 65 | IPR004827 | Basic-leucine zipper domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 84 aa Download sequence Send to blast |
XGVSSDDGHK SVRAMKNRES ALRSRARKRA YTQELEKEVR RLVEDNLKLK RQCKQLQSEI 60 AALTAQQASS KQSSPHRRTS STQF |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | EU307116 | 1e-109 | EU307116.1 Triticum aestivum FD-like 15 protein mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020174160.1 | 2e-52 | bZIP transcription factor 27-like | ||||
| TrEMBL | A0A3B6B4M7 | 1e-51 | A0A3B6B4M7_WHEAT; Uncharacterized protein | ||||
| TrEMBL | T1MZ37 | 7e-52 | T1MZ37_TRIUA; Uncharacterized protein | ||||
| STRING | Traes_2AL_3D7807781.1 | 2e-52 | (Triticum aestivum) | ||||
| STRING | TRIUR3_23318-P1 | 1e-52 | (Triticum urartu) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP4017 | 30 | 72 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G35900.1 | 5e-12 | bZIP family protein | ||||




