![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | TRIUR3_25064-P1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
| Family | MYB | ||||||||
| Protein Properties | Length: 116aa MW: 13379.3 Da PI: 10.8393 | ||||||||
| Description | MYB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 52.6 | 1e-16 | 16 | 63 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
+g+WT eEd++lv ++ +G g+W+ ar g++R +k+c++rw++yl
TRIUR3_25064-P1 16 KGPWTLEEDLILVGYISHHGEGSWDNLARSAGLNRNGKSCRLRWLNYL 63
79*********************************************7 PP
| |||||||
| 2 | Myb_DNA-binding | 51.6 | 2.2e-16 | 69 | 112 | 1 | 46 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
rg+ ++eEd + +++ +lG++ W+ Ia++++ gRt++++k++w++
TRIUR3_25064-P1 69 RGSISPEEDMVIRELHSRLGNK-WAEIAKHLP-GRTDNEVKNYWRT 112
7889******************.*********.***********96 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 17.185 | 11 | 63 | IPR017930 | Myb domain |
| SuperFamily | SSF46689 | 2.06E-31 | 14 | 110 | IPR009057 | Homeodomain-like |
| SMART | SM00717 | 3.1E-12 | 15 | 65 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 7.0E-15 | 16 | 63 | IPR001005 | SANT/Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 9.1E-21 | 17 | 69 | IPR009057 | Homeodomain-like |
| CDD | cd00167 | 4.57E-9 | 18 | 63 | No hit | No description |
| PROSITE profile | PS51294 | 24.596 | 64 | 116 | IPR017930 | Myb domain |
| SMART | SM00717 | 2.5E-14 | 68 | 116 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 4.4E-15 | 69 | 112 | IPR001005 | SANT/Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 2.4E-24 | 70 | 116 | IPR009057 | Homeodomain-like |
| CDD | cd00167 | 7.28E-11 | 73 | 112 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 116 aa Download sequence Send to blast |
MARMMCGRAG EPAVRKGPWT LEEDLILVGY ISHHGEGSWD NLARSAGLNR NGKSCRLRWL 60 NYLRPGLRRG SISPEEDMVI RELHSRLGNK WAEIAKHLPG RTDNEVKNYW RTRAKR |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1h8a_C | 3e-29 | 12 | 116 | 23 | 126 | MYB TRANSFORMING PROTEIN |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor involved in photomorphogenesis in the light. May act downstream of the light receptor network and directly affects transcription of light-induced genes. In darkness, its probable degradation prevent the activation of light-induced genes. Required to activate expression of PAL. Acts redundantly with MYB24 and MYB57 to control stamen filament elongation in the late developed flowers. Contributes with MYB24 to induction of MYB108 by jasmonate. Repressed at the transcript levels by DELLA proteins. {ECO:0000269|PubMed:11967090, ECO:0000269|PubMed:16805732, ECO:0000269|PubMed:19091873, ECO:0000269|PubMed:19325888, ECO:0000269|PubMed:21447791}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Up-regulated by jasmonate. {ECO:0000269|PubMed:16805732}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AK375516 | 1e-151 | AK375516.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, partial cds, clone: NIASHv3096J04. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020161957.1 | 5e-78 | myb-related protein 340-like | ||||
| Swissprot | Q9LK95 | 4e-54 | MYB21_ARATH; Transcription factor MYB21 | ||||
| TrEMBL | M8A6S2 | 6e-79 | M8A6S2_TRIUA; Transcription factor MYB21 | ||||
| TrEMBL | M8C0C2 | 2e-77 | M8C0C2_AEGTA; Transcription factor MYB21 | ||||
| STRING | EMT27664 | 4e-78 | (Aegilops tauschii) | ||||
| STRING | TRIUR3_25064-P1 | 1e-79 | (Triticum urartu) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP13240 | 26 | 33 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G27810.1 | 2e-56 | myb domain protein 21 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




