![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | TRIUR3_27077-P1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 102aa MW: 11611.6 Da PI: 11.7913 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 75 | 5.9e-24 | 11 | 60 | 2 | 51 |
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
rien + rq fskRr g++KKA+EL LCd+ev++++fs+ g++yey+s
TRIUR3_27077-P1 11 RIENRTSRQGRFSKRRSGLFKKAFELALLCDTEVSLLVFSPAGRFYEYAS 60
8***********************************************86 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00432 | 1.2E-29 | 2 | 61 | IPR002100 | Transcription factor, MADS-box |
| PROSITE profile | PS50066 | 27.684 | 2 | 62 | IPR002100 | Transcription factor, MADS-box |
| SuperFamily | SSF55455 | 4.97E-25 | 4 | 65 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.7E-25 | 4 | 24 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 4.9E-22 | 11 | 58 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.7E-25 | 24 | 39 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.7E-25 | 39 | 60 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 102 aa Download sequence Send to blast |
MARRGRVELR RIENRTSRQG RFSKRRSGLF KKAFELALLC DTEVSLLVFS PAGRFYEYAS 60 SSLCAVRVFG SSKALLLRPH SSPVIGYERV VKAAACKMQR RQ |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor involved in the regulation of flowering time under short day (SD) conditions. Functions as promoter of flowering under SD conditions, upstream of EHD1, HD3A and MADS14, but downstream of GIGANTEA (GI). May transmit a SD promotion signal from GI to EHD1. Functions independently of MADS50 to control flowering time. {ECO:0000269|PubMed:17951465}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | DQ512366 | 1e-86 | DQ512366.1 Triticum aestivum MADS-box transcription factor TaAGL33 (AGL33) mRNA, complete cds. | |||
| GenBank | HG670306 | 1e-86 | HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020147090.1 | 3e-32 | MADS-box transcription factor 51-like | ||||
| Swissprot | Q9XJ61 | 9e-30 | MAD51_ORYSJ; MADS-box transcription factor 51 | ||||
| TrEMBL | M7ZZU8 | 4e-66 | M7ZZU8_TRIUA; MADS-box transcription factor 56 | ||||
| STRING | TRIUR3_27077-P1 | 8e-67 | (Triticum urartu) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP129 | 38 | 398 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G45660.1 | 1e-25 | AGAMOUS-like 20 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




