 |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | TRIUR3_27138-P1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
| Family | SBP | ||||||||
| Protein Properties | Length: 100aa MW: 11479.1 Da PI: 9.4342 | ||||||||
| Description | SBP family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SBP | 71.1 | 2e-22 | 2 | 48 | 1 | 47 |
--SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTS CS
SBP 1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCs 47
+CqvegC +dls k+y+ rhkvC hskap v+v+g+eqrfCqqCs
TRIUR3_27138-P1 2 RCQVEGCGVDLSGGKTYYCRHKVCLEHSKAPLVVVAGIEQRFCQQCS 48
6*********************************************9 PP
| |||||||
| 2 | SBP | 45.5 | 2e-14 | 72 | 100 | 47 | 75 |
SSEEETTT--SS--S-STTTT-------S CS
SBP 47 srfhelsefDeekrsCrrrLakhnerrrk 75
fh+l efD++krsCrrrLa+hnerrrk
TRIUR3_27138-P1 72 CEFHQLPEFDQGKRSCRRRLAGHNERRRK 100
57**************************8 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51141 | 25 | 1 | 100 | IPR004333 | Transcription factor, SBP-box |
| Gene3D | G3DSA:4.10.1100.10 | 5.5E-29 | 2 | 88 | IPR004333 | Transcription factor, SBP-box |
| SuperFamily | SSF103612 | 4.81E-28 | 2 | 100 | IPR004333 | Transcription factor, SBP-box |
| Pfam | PF03110 | 5.3E-19 | 3 | 49 | IPR004333 | Transcription factor, SBP-box |
| Pfam | PF03110 | 2.4E-8 | 73 | 100 | IPR004333 | Transcription factor, SBP-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 100 aa Download sequence Send to blast |
XRCQVEGCGV DLSGGKTYYC RHKVCLEHSK APLVVVAGIE QRFCQQCSSG TYSKPRFLFL 60 HLLAVLYAML GCEFHQLPEF DQGKRSCRRR LAGHNERRRK |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1ul4_A | 8e-24 | 3 | 100 | 11 | 84 | squamosa promoter binding protein-like 4 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May be involved in panicle development. {ECO:0000250}. | |||||
| UniProt | Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May be involved in panicle development. {ECO:0000250}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Negatively regulated by microRNAs miR156b and miR156h. {ECO:0000305|PubMed:16861571}. | |||||
| UniProt | INDUCTION: Negatively regulated by microRNAs miR156b and miR156h. {ECO:0000305|PubMed:16861571}. | |||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AK107191 | 1e-39 | AK107191.1 Oryza sativa Japonica Group cDNA clone:002-125-A04, full insert sequence. | |||
| GenBank | AP005816 | 1e-39 | AP005816.3 Oryza sativa Japonica Group genomic DNA, chromosome 8, BAC clone:B1168A08. | |||
| GenBank | AP006049 | 1e-39 | AP006049.2 Oryza sativa Japonica Group genomic DNA, chromosome 8, BAC clone:OSJNBa0016N23. | |||
| GenBank | AP014964 | 1e-39 | AP014964.1 Oryza sativa Japonica Group DNA, chromosome 8, cultivar: Nipponbare, complete sequence. | |||
| GenBank | GU136674 | 1e-39 | GU136674.1 Oryza sativa Japonica Group IPA1 (IPA1) gene, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020188000.1 | 1e-41 | squamosa promoter-binding-like protein 17 isoform X1 | ||||
| Refseq | XP_020188001.1 | 1e-41 | squamosa promoter-binding-like protein 17 isoform X2 | ||||
| Swissprot | A3C057 | 3e-35 | SPL17_ORYSJ; Squamosa promoter-binding-like protein 17 | ||||
| Swissprot | Q7EXZ2 | 4e-35 | SPL14_ORYSJ; Squamosa promoter-binding-like protein 14 | ||||
| TrEMBL | T1N9H5 | 4e-66 | T1N9H5_TRIUA; Uncharacterized protein | ||||
| STRING | TRIUR3_27138-P1 | 6e-67 | (Triticum urartu) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP8524 | 32 | 48 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G42200.1 | 1e-35 | squamosa promoter binding protein-like 9 | ||||
| ©2010-2022, Center
for Bioinformatics, Peking University Last Modified: 2022-12-08 Questions or Comments, please contact  |
Supported By
|