![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | TRIUR3_27975-P1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
| Family | HB-other | ||||||||
| Protein Properties | Length: 61aa MW: 7371.9 Da PI: 4.6441 | ||||||||
| Description | HB-other family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Homeobox | 25.7 | 1.9e-08 | 3 | 33 | 25 | 55 |
--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
Homeobox 25 psaeereeLAkklgLterqVkvWFqNrRake 55
+++++ ++L ++l+++ + +k WF NrRa++
TRIUR3_27975-P1 3 LDEDQHAHLGRELRVEPQHIKLWFNNRRAQM 33
789999***********************86 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50071 | 9.539 | 1 | 36 | IPR001356 | Homeobox domain |
| Gene3D | G3DSA:1.10.10.60 | 5.3E-7 | 3 | 32 | IPR009057 | Homeodomain-like |
| Pfam | PF00046 | 7.1E-6 | 3 | 33 | IPR001356 | Homeobox domain |
| SuperFamily | SSF46689 | 1.5E-6 | 3 | 47 | IPR009057 | Homeodomain-like |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 61 aa Download sequence Send to blast |
MDLDEDQHAH LGRELRVEPQ HIKLWFNNRR AQMTRARHEQ VDNHLSDSEN DEIDSENDEI 60 H |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| TrEMBL | M7YB15 | 6e-36 | M7YB15_TRIUA; Homeobox-leucine zipper protein ROC8 | ||||
| STRING | TRIUR3_27975-P1 | 1e-36 | (Triticum urartu) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP37023 | 3 | 3 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G73360.1 | 2e-09 | homeodomain GLABROUS 11 | ||||




