PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

TRIUR3_29543-P1

Organism

Triticum urartu

Taxonomic ID

4572

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum

Family

NAC

Protein Properties

Length: 139aa MW: 16548.1 Da PI: 10.1601

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
TRIUR3_29543-P1	genome	BGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	161.3	3.6e-50	2	126	3	128
NAM 3 pGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskk 96 pGfrFhPt+eel+ +yL++kveg+++++ e i+ +d+y+++Pw+Lp+++ +ekew+f+++rd+ky++g+r+nr+t+sgyWkatg d+ + ++ TRIUR3_29543-P1 2 PGFRFHPTEEELIEFYLRRKVEGRRFNV-ELITFLDLYRFDPWELPAMAVIGEKEWFFYVPRDRKYRNGDRPNRVTASGYWKATGADRMIRGEN 94 9*************************.89***********7777899************************************* PP NAM 97 gelvglkktLvfykgrapkgektdWvmheyrl 128 ++ +glkktLvfy+g+apkg++++W+m+eyrl TRIUR3_29543-P1 95 SRPIGLKKTLVFYSGKAPKGVRSSWIMNEYRL 126 ****************************98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51005	51.537	1	139	IPR003441	NAC domain
SuperFamily	SSF101941	5.49E-54	2	132	IPR003441	NAC domain
Pfam	PF02365	8.8E-26	2	126	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 139 aa Download sequence Send to blast
MPGFRFHPTE EELIEFYLRR KVEGRRFNVE LITFLDLYRF DPWELPAMAV IGEKEWFFYV 60 PRDRKYRNGD RPNRVTASGY WKATGADRMI RGENSRPIGL KKTLVFYSGK APKGVRSSWI 120 MNEYRLPPPT TDADLFYKI

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ut4_A	1e-54	2	130	19	146	NO APICAL MERISTEM PROTEIN
1ut4_B	1e-54	2	130	19	146	NO APICAL MERISTEM PROTEIN
1ut7_A	1e-54	2	130	19	146	NO APICAL MERISTEM PROTEIN
1ut7_B	1e-54	2	130	19	146	NO APICAL MERISTEM PROTEIN
3swm_A	1e-54	2	130	22	149	NAC domain-containing protein 19
3swm_B	1e-54	2	130	22	149	NAC domain-containing protein 19
3swm_C	1e-54	2	130	22	149	NAC domain-containing protein 19
3swm_D	1e-54	2	130	22	149	NAC domain-containing protein 19
3swp_A	1e-54	2	130	22	149	NAC domain-containing protein 19
3swp_B	1e-54	2	130	22	149	NAC domain-containing protein 19
3swp_C	1e-54	2	130	22	149	NAC domain-containing protein 19
3swp_D	1e-54	2	130	22	149	NAC domain-containing protein 19
4dul_A	1e-54	2	130	19	146	NAC domain-containing protein 19
4dul_B	1e-54	2	130	19	146	NAC domain-containing protein 19
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that acts as a floral repressor. Controls flowering time by negatively regulating CONSTANS (CO) expression in a GIGANTEA (GI)-independent manner. Regulates the plant cold response by positive regulation of the cold response genes COR15A and KIN1. May coordinate cold response and flowering time. {ECO:0000269\|PubMed:17653269}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Circadian regulation with a peak of expression at dawn under continuous light conditions (PubMed:17653269). Circadian regulation with a peak of expression around dusk and lowest expression around dawn under continuous light conditions (at protein level) (PubMed:17653269). {ECO:0000269\|PubMed:17653269}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AK102902	1e-155	AK102902.1 Oryza sativa Japonica Group cDNA clone:J033113D13, full insert sequence.
GenBank	FR819762	1e-155	FR819762.1 Hordeum vulgare subsp. vulgare mRNA for NAC transcription factor (NAC012 gene).

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020183242.1	2e-98	transcription factor JUNGBRUNNEN 1-like
Swissprot	Q9ZVP8	2e-85	NAC35_ARATH; NAC domain-containing protein 35
TrEMBL	A0A452Z4X8	4e-98	A0A452Z4X8_AEGTS; Uncharacterized protein
TrEMBL	A0A452Z511	6e-98	A0A452Z511_AEGTS; Uncharacterized protein
STRING	EMT07151	6e-98	(Aegilops tauschii)
STRING	OMERI05G13800.1	7e-98	(Oryza meridionalis)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP2826	37	87

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G02450.2	8e-88	NAC domain containing protein 35

Publications ? help Back to Top
Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Okajima K Molecular mechanism of phototropin light signaling. J. Plant Res., 2016. 129(2): p. 149-57 [PMID:26815763] Nakasone Y,Ohshima M,Okajima K,Tokutomi S,Terazima M Photoreaction Dynamics of LOV1 and LOV2 of Phototropin from Chlamydomonas reinhardtii. J Phys Chem B, 2018. 122(6): p. 1801-1815 [PMID:29355019]