![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | TRIUR3_30073-P1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 118aa MW: 13288.4 Da PI: 10.2911 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 87.6 | 6.8e-28 | 11 | 60 | 2 | 51 |
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
rie+ +nrqv fskRr g++KKA+ELS LCda+va+++fs+ gklyeyss
TRIUR3_30073-P1 11 RIEDRTNRQVCFSKRRSGLFKKAFELSLLCDADVALLVFSPAGKLYEYSS 60
8***********************************************96 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50066 | 29.422 | 2 | 62 | IPR002100 | Transcription factor, MADS-box |
| SMART | SM00432 | 2.5E-34 | 2 | 61 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 3.91E-35 | 3 | 61 | No hit | No description |
| SuperFamily | SSF55455 | 7.46E-28 | 4 | 74 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 2.1E-28 | 4 | 24 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 4.0E-27 | 11 | 58 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 2.1E-28 | 24 | 39 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 2.1E-28 | 39 | 60 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 118 aa Download sequence Send to blast |
MARRGRVELR RIEDRTNRQV CFSKRRSGLF KKAFELSLLC DADVALLVFS PAGKLYEYSS 60 SRCTLAAAHF FFTCSSKPVL WIRLVESADR GVRSVDFLRF PLSLTVADGC SAGRTPYA |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 3mu6_A | 3e-17 | 4 | 61 | 2 | 59 | Myocyte-specific enhancer factor 2A |
| 3mu6_B | 3e-17 | 4 | 61 | 2 | 59 | Myocyte-specific enhancer factor 2A |
| 3mu6_C | 3e-17 | 4 | 61 | 2 | 59 | Myocyte-specific enhancer factor 2A |
| 3mu6_D | 3e-17 | 4 | 61 | 2 | 59 | Myocyte-specific enhancer factor 2A |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor involved in the regulation of flowering time under short day (SD) conditions. Functions as promoter of flowering under SD conditions, upstream of EHD1, HD3A and MADS14, but downstream of GIGANTEA (GI). May transmit a SD promotion signal from GI to EHD1. Functions independently of MADS50 to control flowering time. {ECO:0000269|PubMed:17951465}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | HG670306 | 6e-79 | HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020181347.1 | 1e-32 | MADS-box transcription factor 51-like | ||||
| Swissprot | Q9XJ61 | 9e-30 | MAD51_ORYSJ; MADS-box transcription factor 51 | ||||
| TrEMBL | A0A446P0R0 | 4e-79 | A0A446P0R0_TRITD; Uncharacterized protein | ||||
| TrEMBL | M7XDP3 | 4e-79 | M7XDP3_TRIUA; Agamous-like MADS-box protein AGL14 | ||||
| STRING | TRIUR3_30073-P1 | 7e-80 | (Triticum urartu) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP129 | 38 | 398 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G11880.1 | 2e-26 | AGAMOUS-like 14 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




