![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | TRIUR3_30803-P1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 135aa MW: 14712.2 Da PI: 10.7114 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 53.8 | 4.3e-17 | 61 | 108 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
+g+WT+eEd++lvd ++ G g+W++ ++ ++R++k+c++rw +yl
TRIUR3_30803-P1 61 KGPWTPEEDKQLVDFIQANGHGSWRLLPKLAELNRCGKSCRLRWTNYL 108
79********************************************97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.10.60 | 1.7E-23 | 52 | 111 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS51294 | 23.506 | 56 | 112 | IPR017930 | Myb domain |
| SMART | SM00717 | 3.7E-13 | 60 | 110 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 1.2E-15 | 61 | 108 | IPR001005 | SANT/Myb domain |
| SuperFamily | SSF46689 | 7.43E-22 | 62 | 135 | IPR009057 | Homeodomain-like |
| CDD | cd00167 | 7.32E-11 | 63 | 108 | No hit | No description |
| Gene3D | G3DSA:1.10.10.60 | 1.8E-7 | 112 | 135 | IPR009057 | Homeodomain-like |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 135 aa Download sequence Send to blast |
MAVEVVSSGV VALAAVLRSR LLLLVLVGLA SMTTSSSCSG ARGRSLPMGR APCCDRKGLK 60 KGPWTPEEDK QLVDFIQANG HGSWRLLPKL AELNRCGKSC RLRWTNYLRP DIKRGPFTAE 120 EQKSIVQLHG IVGNK |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1a5j_A | 3e-16 | 59 | 135 | 5 | 80 | B-MYB |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor that acts as negative regulator of lateral root (LR) development. Required for normal auxin responses during LR development. May be part of a negative feedback loop stimulated specifically in the endodermis upon LR initiation to ensure that LRs are formed only in the correct place. {ECO:0000269|PubMed:24902892}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Induced by abscisic acid (ABA), auxin and gravity in roots. {ECO:0000269|PubMed:24902892}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AK108621 | 1e-119 | AK108621.1 Oryza sativa Japonica Group cDNA clone:002-147-D04, full insert sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020168349.1 | 4e-62 | transcription factor MYB6 | ||||
| Swissprot | Q9S9Z2 | 3e-49 | MYB93_ARATH; Transcription factor MYB93 | ||||
| TrEMBL | M7YZA3 | 2e-93 | M7YZA3_TRIUA; Myb-related protein Myb4 | ||||
| STRING | TRIUR3_30803-P1 | 3e-94 | (Triticum urartu) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP5409 | 31 | 57 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G34670.1 | 2e-50 | myb domain protein 93 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




