PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

TRIUR3_31959-P1

Organism

Triticum urartu

Taxonomic ID

4572

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum

Family

WRKY

Protein Properties

Length: 147aa MW: 16380.2 Da PI: 8.9886

Description

WRKY family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
TRIUR3_31959-P1	genome	BGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	WRKY	104.7	5.1e-33	15	73	1	59
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDgy+WrKYGqK vk+s fprsYYrCt a+C vkk vers++dp++v++tYeg+H h+ TRIUR3_31959-P1 15 LDDGYRWRKYGQKAVKNSSFPRSYYRCTAAQCGVKKLVERSQQDPSTVVTTYEGRHGHP 73 59********************************************************7 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:2.20.25.80	5.8E-33	3	75	IPR003657	WRKY domain
SuperFamily	SSF118290	8.24E-29	8	75	IPR003657	WRKY domain
PROSITE profile	PS50811	30.458	10	75	IPR003657	WRKY domain
SMART	SM00774	4.1E-36	15	74	IPR003657	WRKY domain
Pfam	PF03106	5.3E-26	16	73	IPR003657	WRKY domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 147 aa Download sequence Send to blast
GSRVAFATKS EVDHLDDGYR WRKYGQKAVK NSSFPRSYYR CTAAQCGVKK LVERSQQDPS 60 TVVTTYEGRH GHPSPIIAHH GARMLMATSA DTAYSLAALQ HHQHGFFPTG TDVYTSSVAH 120 RVSEYGGIQF HDDLLPDATM GYQQGYR

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1wj2_A	3e-28	8	75	10	77	Probable WRKY transcription factor 4
2lex_A	3e-28	8	75	10	77	Probable WRKY transcription factor 4
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.
UniProt	Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	KR827397	1e-154	KR827397.1 Triticum aestivum WRKY46 transcriptional factor mRNA, partial cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020180589.1	6e-90	probable WRKY transcription factor 23 isoform X1
Swissprot	O22900	1e-37	WRK23_ARATH; WRKY transcription factor 23
Swissprot	Q93WV4	5e-38	WRK71_ARATH; WRKY transcription factor 71
TrEMBL	T1NMJ8	1e-106	T1NMJ8_TRIUA; Uncharacterized protein
STRING	TRIUR3_31959-P1	1e-106	(Triticum urartu)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP623	37	173

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G29860.1	2e-40	WRKY DNA-binding protein 71

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Guo D, et al. The WRKY Transcription Factor WRKY71/EXB1 Controls Shoot Branching by Transcriptionally Regulating RAX Genes in Arabidopsis. Plant Cell, 2015. 27(11): p. 3112-27 [PMID:26578700] Yu Y, et al. WRKY71 accelerates flowering via the direct activation of FLOWERING LOCUS T and LEAFY in Arabidopsis thaliana. Plant J., 2016. 85(1): p. 96-106 [PMID:26643131] Guo D,Qin G EXB1/WRKY71 transcription factor regulates both shoot branching and responses to abiotic stresses. Plant Signal Behav, 2016. 11(3): p. e1150404 [PMID:26914912] Yu Y, et al. WRKY71 Acts Antagonistically Against Salt-Delayed Flowering in Arabidopsis thaliana. Plant Cell Physiol., 2018. 59(2): p. 414-422 [PMID:29272465] Prát T, et al. WRKY23 is a component of the transcriptional network mediating auxin feedback on PIN polarity. PLoS Genet., 2018. 14(1): p. e1007177 [PMID:29377885]