![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | TRIUR3_33662-P1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
| Family | WRKY | ||||||||
| Protein Properties | Length: 112aa MW: 12512 Da PI: 9.7417 | ||||||||
| Description | WRKY family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | WRKY | 97.6 | 8.2e-31 | 28 | 85 | 2 | 59 |
--SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
WRKY 2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
+Dgy+WrKYG+K+vk+s++pr+YYrC+++gC+vkk+ver+++d ++v+++Yeg Hnh
TRIUR3_33662-P1 28 EDGYKWRKYGKKSVKNSPNPRNYYRCSTEGCSVKKRVERDKDDANYVVTMYEGVHNHA 85
8********************************************************6 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:2.20.25.80 | 8.2E-33 | 15 | 87 | IPR003657 | WRKY domain |
| SuperFamily | SSF118290 | 9.94E-28 | 19 | 87 | IPR003657 | WRKY domain |
| PROSITE profile | PS50811 | 30.262 | 22 | 87 | IPR003657 | WRKY domain |
| SMART | SM00774 | 1.7E-33 | 27 | 86 | IPR003657 | WRKY domain |
| Pfam | PF03106 | 3.0E-24 | 28 | 84 | IPR003657 | WRKY domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 112 aa Download sequence Send to blast |
MPSSSRAAAV AASGKIAFRT RSEEEILEDG YKWRKYGKKS VKNSPNPRNY YRCSTEGCSV 60 KKRVERDKDD ANYVVTMYEG VHNHASPGTI YYAAQDPASG RFFVTGTHQL AP |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1wj2_A | 2e-25 | 11 | 87 | 1 | 77 | Probable WRKY transcription factor 4 |
| 2lex_A | 2e-25 | 11 | 87 | 1 | 77 | Probable WRKY transcription factor 4 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). Involved in defense responses. May act as positive regulator of salicylic acid (SA)-mediated signaling and negative regulator of jasmonic acid (JA)-mediated signaling (PubMed:21030507). {ECO:0000250, ECO:0000269|PubMed:21030507}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | DQ840417 | 1e-100 | DQ840417.1 Hordeum vulgare subsp. vulgare WRKY transcription factor 18 (WRKY18) mRNA, partial cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020195304.1 | 3e-72 | probable WRKY transcription factor 59 isoform X1 | ||||
| Swissprot | Q93WU9 | 1e-37 | WRK51_ARATH; Probable WRKY transcription factor 51 | ||||
| TrEMBL | M7Y8I1 | 2e-78 | M7Y8I1_TRIUA; Putative WRKY transcription factor 51 | ||||
| STRING | TRIUR3_33662-P1 | 3e-79 | (Triticum urartu) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP441 | 37 | 206 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G64810.1 | 1e-39 | WRKY DNA-binding protein 51 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




