 |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | TRIUR3_33976-P1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
| Family | G2-like | ||||||||
| Protein Properties | Length: 144aa MW: 15594.2 Da PI: 6.22 | ||||||||
| Description | G2-like family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | G2-like | 98.7 | 4.1e-31 | 1 | 52 | 4 | 55 |
G2-like 4 lrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
TRIUR3_33976-P1 1 MRWTSTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 52
79*************************************************7 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| TIGRFAMs | TIGR01557 | 2.1E-23 | 1 | 52 | IPR006447 | Myb domain, plants |
| Pfam | PF00249 | 4.8E-7 | 1 | 51 | IPR001005 | SANT/Myb domain |
| PROSITE profile | PS51294 | 9.789 | 1 | 55 | IPR017930 | Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 3.2E-27 | 1 | 53 | IPR009057 | Homeodomain-like |
| SuperFamily | SSF46689 | 1.79E-14 | 1 | 53 | IPR009057 | Homeodomain-like |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0009887 | Biological Process | organ morphogenesis | ||||
| GO:0009944 | Biological Process | polarity specification of adaxial/abaxial axis | ||||
| GO:0009956 | Biological Process | radial pattern formation | ||||
| GO:0010051 | Biological Process | xylem and phloem pattern formation | ||||
| GO:0010158 | Biological Process | abaxial cell fate specification | ||||
| GO:0048481 | Biological Process | plant ovule development | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 144 aa Download sequence Send to blast |
MRWTSTLHAR FVHAVELLGG HERATPKSVL ELMDVKDLTL AHVKSHLQMY RTVKSTDKPA 60 ASGPTDGGSG DDDFPSAGGQ AGRDPWLSSN SCNMDAHRSI GLSSPMENME PCRSTGSQVS 120 NHELSSPSLE FTLGRPDWHG ADHD |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 6j4k_A | 3e-17 | 1 | 54 | 5 | 58 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j4k_B | 3e-17 | 1 | 54 | 5 | 58 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j5b_A | 3e-17 | 1 | 54 | 5 | 58 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j5b_C | 3e-17 | 1 | 54 | 5 | 58 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j5b_D | 3e-17 | 1 | 54 | 5 | 58 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j5b_F | 3e-17 | 1 | 54 | 5 | 58 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j5b_H | 3e-17 | 1 | 54 | 5 | 58 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j5b_J | 3e-17 | 1 | 54 | 5 | 58 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional repressor that regulates lateral organ polarity. Promotes lateral organ abaxial identity by repressing the adaxial regulator ASYMMETRIC LEAVES2 (AS2) in abaxial cells. Required for abaxial identity in both leaves and carpels. Functions with KAN2 in the specification of polarity of the ovule outer integument. Regulates cambium activity by repressing the auxin efflux carrier PIN1. Plays a role in lateral root formation and development. {ECO:0000269|PubMed:11395775, ECO:0000269|PubMed:11525739, ECO:0000269|PubMed:14561401, ECO:0000269|PubMed:15286295, ECO:0000269|PubMed:16623911, ECO:0000269|PubMed:17307928, ECO:0000269|PubMed:18849474, ECO:0000269|PubMed:20179097}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Repressed by AS2 in adaxial tissue. {ECO:0000269|PubMed:18849474}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AK377103 | 1e-118 | AK377103.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3148F08. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020150556.1 | 8e-86 | probable transcription factor RL9 | ||||
| Swissprot | Q93WJ9 | 1e-41 | KAN1_ARATH; Transcription repressor KAN1 | ||||
| TrEMBL | M7ZHJ7 | 1e-102 | M7ZHJ7_TRIUA; Transcription repressor KAN1 | ||||
| STRING | TRIUR3_33976-P1 | 1e-102 | (Triticum urartu) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP2558 | 37 | 87 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G16560.1 | 2e-37 | G2-like family protein | ||||
| ©2010-2022, Center
for Bioinformatics, Peking University Last Modified: 2022-12-08 Questions or Comments, please contact  |
Supported By
|