![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | TRIUR3_35146-P1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 126aa MW: 13890.8 Da PI: 11.3905 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 50.4 | 5e-16 | 22 | 66 | 3 | 47 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
+WT++E+ +++ + ++lG+g+W+ I+r++ ++Rt+ q+ s+ qky
TRIUR3_35146-P1 22 PWTEDEHRRFLAGLEKLGKGDWRGISRHFVTTRTPTQVASHAQKY 66
8*******************************************9 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 20.245 | 15 | 71 | IPR017930 | Myb domain |
| SuperFamily | SSF46689 | 8.61E-19 | 16 | 71 | IPR009057 | Homeodomain-like |
| TIGRFAMs | TIGR01557 | 1.6E-19 | 18 | 70 | IPR006447 | Myb domain, plants |
| Gene3D | G3DSA:1.10.10.60 | 4.7E-12 | 19 | 65 | IPR009057 | Homeodomain-like |
| SMART | SM00717 | 1.5E-11 | 19 | 69 | IPR001005 | SANT/Myb domain |
| CDD | cd00167 | 5.16E-11 | 22 | 67 | No hit | No description |
| Pfam | PF00249 | 5.1E-13 | 22 | 66 | IPR001005 | SANT/Myb domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 126 aa Download sequence Send to blast |
MGHGYLSDGL MGRAQERKKG VPWTEDEHRR FLAGLEKLGK GDWRGISRHF VTTRTPTQVA 60 SHAQKYFLRQ AGLAQKKRRS SLFDVAPDLE LKISSTAARK TDQQAGAAAG SSPSPRTPFL 120 GTIRVT |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription repressor that binds to 5'-TATCCA-3' elements in gene promoters. Contributes to the sugar-repressed transcription of promoters containing SRS or 5'-TATCCA-3' elements. Transcription repressor involved in a cold stress response pathway that confers cold tolerance. Suppresses the DREB1-dependent signaling pathway under prolonged cold stress. DREB1 responds quickly and transiently while MYBS3 responds slowly to cold stress. They may act sequentially and complementarily for adaptation to short- and long-term cold stress (PubMed:20130099). {ECO:0000269|PubMed:12172034, ECO:0000269|PubMed:20130099}. | |||||
| Binding Motif ? help Back to Top | |||
|---|---|---|---|
| Motif ID | Method | Source | Motif file |
| MP00565 | DAP | Transfer from AT5G56840 | Download |
| |||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Repressed by sucrose and gibberellic acid (GA) (PubMed:12172034). Induced by cold stress in roots and shoots. Induced by salt stress in shoots. Down-regulated by abscisic aci (ABA) in shoots (PubMed:20130099). {ECO:0000269|PubMed:12172034, ECO:0000269|PubMed:20130099}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | - | Retrieve | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | KJ624399 | 1e-141 | KJ624399.1 Triticum aestivum MYBSM151 mRNA, complete cds. | |||
| GenBank | KP330479 | 1e-141 | KP330479.1 Triticum aestivum MYB transcription factor SM151 mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020153631.1 | 7e-57 | uncharacterized protein LOC109738954 | ||||
| Swissprot | Q7XC57 | 4e-39 | MYBS3_ORYSJ; Transcription factor MYBS3 | ||||
| TrEMBL | M7Z095 | 1e-86 | M7Z095_TRIUA; Transcription factor MYB1R1 | ||||
| STRING | TRIUR3_35146-P1 | 2e-87 | (Triticum urartu) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP4231 | 38 | 73 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G56840.1 | 1e-40 | MYB_related family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




