PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG001465t1
Common NameTCM_001465
Organism
Theobroma cacao
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family NAC
Protein Properties Length: 64aa    MW: 7502.79 Da    PI: 10.0339
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG001465t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM576.5e-18653149
               NAM  1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk 49
                      l+pGfrFhPtd el+++yL++kv gkk+++ e+i+e+d+yk+ PwdLp 
  Thecc1EG001465t1  6 LAPGFRFHPTDVELLKYYLRRKVLGKKFRF-EAIAELDLYKYAPWDLPD 53
                      679**************************9.89**************94 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.89E-19357IPR003441NAC domain
PROSITE profilePS5100520.227663IPR003441NAC domain
PfamPF023655.0E-8842IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 64 aa     Download sequence    Send to blast
MEKNSLAPGF RFHPTDVELL KYYLRRKVLG KKFRFEAIAE LDLYKYAPWD LPDKSLLRTG  60
DLK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-155571466Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator that binds specific DNA sequences on the promoter regions of target genes. {ECO:0000250|UniProtKB:Q9C8W9}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017977109.13e-37PREDICTED: NAC domain-containing protein 82
SwissprotQ9FY822e-24NAC82_ARATH; NAC domain-containing protein 82
TrEMBLA0A061DJJ01e-37A0A061DJJ0_THECC; Transcription factor, putative
STRINGEOX925222e-38(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM79671340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G64060.17e-29NAC domain containing protein 103
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Deeken R, et al.
    Identification of Arabidopsis thaliana phloem RNAs provides a search criterion for phloem-based transcripts hidden in complex datasets of microarray experiments.
    Plant J., 2008. 55(5): p. 746-59
    [PMID:18485061]
  3. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]
  4. Ohbayashi I, et al.
    Evidence for a Role of ANAC082 as a Ribosomal Stress Response Mediator Leading to Growth Defects and Developmental Alterations in Arabidopsis.
    Plant Cell, 2017. 29(10): p. 2644-2660
    [PMID:28899981]