PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Thecc1EG013990t1

Common Name

TCM_013990

Organism

Theobroma cacao

Taxonomic ID

3641

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma

Family

ZF-HD

Protein Properties

Length: 90aa MW: 9672.81 Da PI: 8.3808

Description

ZF-HD family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Thecc1EG013990t1	genome	CGD	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	ZF-HD_dimer	107.3	8.9e-34	23	79	3	60
ZF-HD_dimer 3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60 +vrY eC+kNhAa++Gg+avDGC+Efm+s geegt+ al+CaACgCHRnFHRreve+e Thecc1EG013990t1 23 NVRYGECQKNHAANIGGYAVDGCREFMAS-GEEGTTGALTCAACGCHRNFHRREVETE 79 79************************9.999*******************9986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
ProDom	PD125774	5.0E-30	1	88	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Pfam	PF04770	4.1E-31	23	76	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMs	TIGR01566	1.5E-27	25	76	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profile	PS51523	26.118	26	75	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0048509	Biological Process	regulation of meristem development

Sequence ? help Back to Top
Protein Sequence Length: 90 aa Download sequence Send to blast
MKKRQVVLKS GRSSSTSSSV IRNVRYGECQ KNHAANIGGY AVDGCREFMA SGEEGTTGAL 60 TCAACGCHRN FHRREVETEV VCEYTPPNS*

Functional Description ? help Back to Top
Source	Description
UniProt	Inhibits zinc finger homeodomain (ZHD) transcription factors by interacting with them to prevent both their nuclear localization and their DNA-binding properties. Involved in integrating signals from multiple hormones by regulating the expression of specific genes. Promotes the formation of ectopic shoot meristems on leaf margins. {ECO:0000269\|PubMed:21455630}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_017972402.1	2e-60	PREDICTED: mini zinc finger protein 1
Swissprot	Q2Q493	6e-42	MIF3_ARATH; Mini zinc finger protein 3
TrEMBL	A0A061G482	5e-59	A0A061G482_THECC; Mini zinc finger
STRING	EOY21844	8e-60	(Theobroma cacao)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM944	28	114

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G18835.1	2e-42	mini zinc finger

Link Out ? help Back to Top
Phytozome	Thecc1EG013990t1
Entrez Gene	18604683

Publications ? help Back to Top
Motamayor JC, et al. The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color. Genome Biol., 2013. 14(6): p. r53 [PMID:23731509]