![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Thecc1EG017198t1 | ||||||||
| Common Name | TCM_017198 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
|
||||||||
| Family | B3 | ||||||||
| Protein Properties | Length: 70aa MW: 7661.95 Da PI: 10.2445 | ||||||||
| Description | B3 family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | B3 | 53.9 | 3.3e-17 | 5 | 64 | 35 | 96 |
EEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEE CS
B3 35 tltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkv 96
+++ + grsW vkl + +++r +lt+GW+ F+k+n L+++D++vF+l+++s++ l+v +
Thecc1EG017198t1 5 RMVILQVAGRSWHVKL--KSYPSRSFLTSGWSLFAKENALQANDICVFELINSSNAVLRVYI 64
57788899********..*********************************99999888876 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50863 | 13.747 | 1 | 68 | IPR003340 | B3 DNA binding domain |
| SuperFamily | SSF101936 | 5.69E-16 | 3 | 67 | IPR015300 | DNA-binding pseudobarrel domain |
| CDD | cd10017 | 1.68E-15 | 3 | 66 | No hit | No description |
| Pfam | PF02362 | 6.9E-15 | 5 | 64 | IPR003340 | B3 DNA binding domain |
| Gene3D | G3DSA:2.40.330.10 | 7.9E-17 | 6 | 65 | IPR015300 | DNA-binding pseudobarrel domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 70 aa Download sequence Send to blast |
MPGTRMVILQ VAGRSWHVKL KSYPSRSFLT SGWSLFAKEN ALQANDICVF ELINSSNAVL 60 RVYISKCAG* |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_017974377.1 | 4e-43 | PREDICTED: B3 domain-containing transcription factor VRN1 isoform X4 | ||||
| TrEMBL | A0A061ECV0 | 6e-44 | A0A061ECV0_THECC; Uncharacterized protein isoform 1 | ||||
| TrEMBL | A0A061ED07 | 1e-43 | A0A061ED07_THECC; Uncharacterized protein isoform 2 (Fragment) | ||||
| STRING | EOY02806 | 2e-44 | (Theobroma cacao) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G18990.1 | 2e-08 | B3 family protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Thecc1EG017198t1 |
| Entrez Gene | 18601014 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




