PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Thecc1EG029832t1

Common Name

TCM_029832

Organism

Theobroma cacao

Taxonomic ID

3641

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma

Family

SBP

Protein Properties

Length: 142aa MW: 16029.7 Da PI: 8.139

Description

SBP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Thecc1EG029832t1	genome	CGD	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SBP	137.6	3.6e-43	56	132	2	78
-SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS SBP 2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 Cqve+C++d+++ak+yhrrhkvCe+h+kapvv vsgl+qrfCqqCsrfhelsefDe+krsCrrrLa+hnerrrk+++ Thecc1EG029832t1 56 CQVENCTTDMNDAKRYHRRHKVCEFHAKAPVVRVSGLQQRFCQQCSRFHELSEFDEAKRSCRRRLAGHNERRRKSSS 132 **************************************************************************976 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PIRSF	PIRSF037575	5.8E-63	1	141	IPR017238	Squamosa promoter-binding protein
Gene3D	G3DSA:4.10.1100.10	1.1E-35	48	117	IPR004333	Transcription factor, SBP-box
PROSITE profile	PS51141	32.847	53	130	IPR004333	Transcription factor, SBP-box
SuperFamily	SSF103612	2.75E-40	54	134	IPR004333	Transcription factor, SBP-box
Pfam	PF03110	2.2E-33	56	129	IPR004333	Transcription factor, SBP-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0009911	Biological Process	positive regulation of flower development
GO:0010228	Biological Process	vegetative to reproductive phase transition of meristem
GO:0010229	Biological Process	inflorescence development
GO:0010321	Biological Process	regulation of vegetative phase change
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0046872	Molecular Function	metal ion binding

Sequence ? help Back to Top
Protein Sequence Length: 142 aa Download sequence Send to blast
MATSRAEGKR SLKEMAEDEE EEEDEDAGAL GFVDEEKKKK GKRGSSTGGG SALPSCQVEN 60 CTTDMNDAKR YHRRHKVCEF HAKAPVVRVS GLQQRFCQQC SRFHELSEFD EAKRSCRRRL 120 AGHNERRRKS SSEYHGEGSN Y*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ul4_A	6e-40	47	129	2	84	squamosa promoter binding protein-like 4
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcriptional factor. Binds to the promoter of the SQUAMOSA gene.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00290	DAP	Transfer from AT2G33810	Download

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_017978774.1	2e-99	PREDICTED: squamosa promoter-binding-like protein 3 isoform X2
Swissprot	Q38741	4e-53	SBP1_ANTMA; Squamosa promoter-binding protein 1
TrEMBL	A0A061GEC8	4e-98	A0A061GEC8_THECC; Squamosa promoter-binding-like protein
STRING	EOY28200	7e-99	(Theobroma cacao)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM868	28	118

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G33810.1	1e-45	squamosa promoter binding protein-like 3

Link Out ? help Back to Top
Phytozome	Thecc1EG029832t1
Entrez Gene	18596814

Publications ? help Back to Top
Motamayor JC, et al. The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color. Genome Biol., 2013. 14(6): p. r53 [PMID:23731509] Klein J,Saedler H,Huijser P A new family of DNA binding proteins includes putative transcriptional regulators of the Antirrhinum majus floral meristem identity gene SQUAMOSA. Mol. Gen. Genet., 1996. 250(1): p. 7-16 [PMID:8569690]