![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Thhalv10001738m | ||||||||
| Common Name | EUTSA_v10001738mg | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
|
||||||||
| Family | WRKY | ||||||||
| Protein Properties | Length: 99aa MW: 11811.6 Da PI: 10.2623 | ||||||||
| Description | WRKY family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | WRKY | 103 | 1.7e-32 | 17 | 75 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
ldDgy+WrKYGqK+vk+s +prsYYrCt++ C+vkk+v+r +++ ++ve+tYeg Hnh+
Thhalv10001738m 17 LDDGYRWRKYGQKSVKNSLYPRSYYRCTQHMCNVKKQVQRLSKERSIVETTYEGIHNHP 75
59********************************************************8 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:2.20.25.80 | 1.0E-32 | 2 | 75 | IPR003657 | WRKY domain |
| SuperFamily | SSF118290 | 3.01E-28 | 10 | 76 | IPR003657 | WRKY domain |
| PROSITE profile | PS50811 | 27.451 | 12 | 77 | IPR003657 | WRKY domain |
| SMART | SM00774 | 2.7E-36 | 17 | 76 | IPR003657 | WRKY domain |
| Pfam | PF03106 | 2.8E-26 | 18 | 75 | IPR003657 | WRKY domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 99 aa Download sequence Send to blast |
MKKSRFAFRT KSDKDILDDG YRWRKYGQKS VKNSLYPRSY YRCTQHMCNV KKQVQRLSKE 60 RSIVETTYEG IHNHPCEEIM QTLTPLLHQM KFLSNFTS* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1wj2_A | 9e-25 | 7 | 74 | 7 | 74 | Probable WRKY transcription factor 4 |
| 2lex_A | 9e-25 | 7 | 74 | 7 | 74 | Probable WRKY transcription factor 4 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. | |||||
| Binding Motif ? help Back to Top | |||
|---|---|---|---|
| Motif ID | Method | Source | Motif file |
| MP00317 | DAP | Transfer from AT2G46130 | Download |
| |||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Thhalv10001738m |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | Retrieve | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AF404861 | 1e-103 | AF404861.1 Arabidopsis thaliana WRKY transcription factor 43 splice variant one (WRKY43) mRNA, complete cds; alternatively spliced. | |||
| GenBank | AK117931 | 1e-103 | AK117931.1 Arabidopsis thaliana At2g46130 mRNA for putative WRKY transcription factor (WRKY43), complete cds, clone: RAFL19-12-A14. | |||
| GenBank | BT004701 | 1e-103 | BT004701.1 Arabidopsis thaliana At2g46130 gene, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_006397797.2 | 1e-69 | probable WRKY transcription factor 43 isoform X2 | ||||
| Swissprot | Q8GY11 | 5e-64 | WRK43_ARATH; Probable WRKY transcription factor 43 | ||||
| TrEMBL | V4KMW8 | 2e-68 | V4KMW8_EUTSA; Uncharacterized protein | ||||
| STRING | XP_006397797.1 | 4e-69 | (Eutrema salsugineum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM509 | 28 | 154 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G46130.1 | 2e-66 | WRKY DNA-binding protein 43 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Thhalv10001738m |
| Entrez Gene | 18015833 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




