![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Thhalv10005251m | ||||||||
| Common Name | EUTSA_v10005251mg | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
|
||||||||
| Family | HSF | ||||||||
| Protein Properties | Length: 61aa MW: 6828.9 Da PI: 7.355 | ||||||||
| Description | HSF family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | HSF_DNA-bind | 31.1 | 6e-10 | 12 | 53 | 2 | 43 |
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHH CS
HSF_DNA-bind 2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpk 43
F k ly ++d+++++++sws++++sf+++d+ f++++L++
Thhalv10005251m 12 FYKALYMFVDDPSMDSIVSWSKSNRSFIIWDPVGFHTRILSR 53
8999***********************************986 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF46785 | 7.8E-10 | 9 | 53 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
| Gene3D | G3DSA:1.10.10.10 | 7.0E-11 | 10 | 55 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
| Pfam | PF00447 | 3.6E-7 | 12 | 53 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 61 aa Download sequence Send to blast |
MAGLSDRALS PFYKALYMFV DDPSMDSIVS WSKSNRSFII WDPVGFHTRI LSRSIGICEI 60 * |
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Thhalv10005251m |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_018487557.1 | 5e-15 | PREDICTED: heat stress transcription factor A-4a-like | ||||
| TrEMBL | V4KNS5 | 6e-36 | V4KNS5_EUTSA; Uncharacterized protein | ||||
| STRING | XP_006394301.1 | 1e-36 | (Eutrema salsugineum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM18172 | 6 | 8 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G22830.1 | 4e-12 | heat shock transcription factor A6B | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Thhalv10005251m |
| Entrez Gene | 18012918 |




