PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Thhalv10009699m

Common Name

EUTSA_v10009699mg

Organism

Eutrema salsugineum

Taxonomic ID

72664

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema

Family

ZF-HD

Protein Properties

Length: 89aa MW: 9651.75 Da PI: 8.1213

Description

ZF-HD family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Thhalv10009699m	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	ZF-HD_dimer	106.1	2.1e-33	22	79	2	60
ZF-HD_dimer 2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60 ++vrY eC+kNhAa++Gg+avDGC+Efm+s g egt +al+CaACgCHR+FHRreve+e Thhalv10009699m 22 SNVRYVECQKNHAANIGGYAVDGCREFMAS-GGEGTDDALTCAACGCHRSFHRREVETE 79 689************************9.8889******************9986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
ProDom	PD125774	8.0E-31	22	88	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Pfam	PF04770	2.2E-30	23	76	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMs	TIGR01566	5.9E-27	25	76	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profile	PS51523	25.433	26	75	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0048509	Biological Process	regulation of meristem development

Sequence ? help Back to Top
Protein Sequence Length: 89 aa Download sequence Send to blast
MKKRQVVVKQ RKGSYTTTSS SSNVRYVECQ KNHAANIGGY AVDGCREFMA SGGEGTDDAL 60 TCAACGCHRS FHRREVETEV VCEYSPPN*

Functional Description ? help Back to Top
Source	Description
UniProt	Inhibits zinc finger homeodomain (ZHD) transcription factors by interacting with them to prevent both their nuclear localization and their DNA-binding properties. Involved in integrating signals from multiple hormones by regulating the expression of specific genes. Promotes the formation of ectopic shoot meristems on leaf margins. {ECO:0000269\|PubMed:21455630}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Thhalv10009699m

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_006416562.1	2e-60	mini zinc finger protein 3
Swissprot	Q2Q493	7e-48	MIF3_ARATH; Mini zinc finger protein 3
TrEMBL	V4KB30	5e-59	V4KB30_EUTSA; Uncharacterized protein
STRING	XP_006416562.1	9e-60	(Eutrema salsugineum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM944	28	114

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G74660.1	1e-42	mini zinc finger 1

Link Out ? help Back to Top
Phytozome	Thhalv10009699m
Entrez Gene	18993032