PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Thhalv10011676m

Common Name

EUTSA_v10011676mg

Organism

Eutrema salsugineum

Taxonomic ID

72664

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema

Family

NAC

Protein Properties

Length: 314aa MW: 35246.3 Da PI: 6.8012

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Thhalv10011676m	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	164.5	3.8e-51	14	139	1	128
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 lppGfrF Ptdeel+v+yL++k++g +++l + i+e+d+yk++Pw Lp+k+ +ekewyfFs+rd+ky++g+r+nr++ sgyWkatg+dk + + Thhalv10011676m 14 LPPGFRFYPTDEELMVQYLCRKAAGYDFSL-QLIAEIDLYKFDPWVLPNKAIFGEKEWYFFSPRDRKYPNGSRPNRVAGSGYWKATGTDKIIST 106 79*************************9.89***********8777899*****************************999988 PP NAM 95 kkgelvglkktLvfykgrapkgektdWvmheyrl 128 +g++vg+kk Lvfy g+apkg+kt+W+mheyrl Thhalv10011676m 107 -EGKKVGIKKALVFYIGKAPKGTKTNWIMHEYRL 139 .999**************************98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	4.84E-66	9	162	IPR003441	NAC domain
PROSITE profile	PS51005	59.639	14	162	IPR003441	NAC domain
Pfam	PF02365	1.2E-25	15	139	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0009414	Biological Process	response to water deprivation
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 314 aa Download sequence Send to blast
MGIQETDPLA QLSLPPGFRF YPTDEELMVQ YLCRKAAGYD FSLQLIAEID LYKFDPWVLP 60 NKAIFGEKEW YFFSPRDRKY PNGSRPNRVA GSGYWKATGT DKIISTEGKK VGIKKALVFY 120 IGKAPKGTKT NWIMHEYRLI ESSRRNGSSK LDDWVLCRIY KKQSSAQRQI YENAIASTRE 180 FSNNGTSSTT SSSSHFEDVL DSLHHEIDNG RNFQFSNPNR FSSLRPELTG EKTGFNGLAD 240 TSSLDWGRFG GNVEHNSGPE LGMSHVVPSL EFNSGYLKTE EEFNNSDELA QKGYAFDSVG 300 FGYPGQVGGF GFM*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ut4_A	1e-120	1	168	4	171	NO APICAL MERISTEM PROTEIN
1ut4_B	1e-120	1	168	4	171	NO APICAL MERISTEM PROTEIN
1ut7_A	1e-120	1	168	4	171	NO APICAL MERISTEM PROTEIN
1ut7_B	1e-120	1	168	4	171	NO APICAL MERISTEM PROTEIN
3swm_A	1e-120	1	168	7	174	NAC domain-containing protein 19
3swm_B	1e-120	1	168	7	174	NAC domain-containing protein 19
3swm_C	1e-120	1	168	7	174	NAC domain-containing protein 19
3swm_D	1e-120	1	168	7	174	NAC domain-containing protein 19
3swp_A	1e-120	1	168	7	174	NAC domain-containing protein 19
3swp_B	1e-120	1	168	7	174	NAC domain-containing protein 19
3swp_C	1e-120	1	168	7	174	NAC domain-containing protein 19
3swp_D	1e-120	1	168	7	174	NAC domain-containing protein 19
4dul_A	1e-120	1	168	4	171	NAC domain-containing protein 19
4dul_B	1e-120	1	168	4	171	NAC domain-containing protein 19
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factors that bind specifically to the 5'-CATGTG-3' motif. {ECO:0000269\|PubMed:15319476}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00012	PBM	Transfer from AT1G52890	Download

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Thhalv10011676m

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by drought, high salinity and abscisic acid (ABA). Slightly up-regulated by jasmonic acid. Not induced by cold treatment. {ECO:0000269\|PubMed:12646039, ECO:0000269\|PubMed:15319476}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	KC966747	0.0	KC966747.1 Brassica napus NAC transcription factor 19 (NAC19.1) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_006392855.1	0.0	NAC domain-containing protein 19
Swissprot	Q9C932	0.0	NAC19_ARATH; NAC domain-containing protein 19
TrEMBL	V4MFR5	0.0	V4MFR5_EUTSA; Uncharacterized protein
STRING	XP_006392855.1	0.0	(Eutrema salsugineum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM1435	27	95

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G52890.1	0.0	NAC domain containing protein 19

Link Out ? help Back to Top
Phytozome	Thhalv10011676m
Entrez Gene	18011136

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Zheng XY, et al. Coronatine promotes Pseudomonas syringae virulence in plants by activating a signaling cascade that inhibits salicylic acid accumulation. Cell Host Microbe, 2012. 11(6): p. 587-96 [PMID:22704619] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Guan Q,Yue X,Zeng H,Zhu J The protein phosphatase RCF2 and its interacting partner NAC019 are critical for heat stress-responsive gene regulation and thermotolerance in Arabidopsis. Plant Cell, 2014. 26(1): p. 438-53 [PMID:24415771] Chen F, et al. Arabidopsis Phytochrome A Directly Targets Numerous Promoters for Individualized Modulation of Genes in a Wide Range of Pathways. Plant Cell, 2014. 26(5): p. 1949-1966 [PMID:24794133] Wang T, et al. Salt-Related MYB1 Coordinates Abscisic Acid Biosynthesis and Signaling during Salt Stress in Arabidopsis. Plant Physiol., 2015. 169(2): p. 1027-41 [PMID:26243618] Zhu X, et al. Jasmonic acid promotes degreening via MYC2/3/4- and ANAC019/055/072-mediated regulation of major chlorophyll catabolic genes. Plant J., 2015. 84(3): p. 597-610 [PMID:26407000] Takasaki H, et al. SNAC-As, stress-responsive NAC transcription factors, mediate ABA-inducible leaf senescence. Plant J., 2015. 84(6): p. 1114-23 [PMID:26518251] Gimenez-Ibanez S, et al. JAZ2 controls stomata dynamics during bacterial invasion. New Phytol., 2017. 213(3): p. 1378-1392 [PMID:28005270] Ueda M, et al. The Distinct Roles of Class I and II RPD3-Like Histone Deacetylases in Salinity Stress Response. Plant Physiol., 2017. 175(4): p. 1760-1773 [PMID:29018096] Kang M, et al. The C-Domain of the NAC Transcription Factor ANAC019 Is Necessary for pH-Tuned DNA Binding through a Histidine Switch in the N-Domain. Cell Rep, 2018. 22(5): p. 1141-1150 [PMID:29386103] Sukiran NL,Ma JC,Ma H,Su Z ANAC019 is required for recovery of reproductive development under drought stress in Arabidopsis. Plant Mol. Biol., 2019. 99(1-2): p. 161-174 [PMID:30604322]