![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Thhalv10017459m | ||||||||
| Common Name | EUTSA_v10017320mg | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
|
||||||||
| Family | YABBY | ||||||||
| Protein Properties | Length: 110aa MW: 12033.7 Da PI: 10.934 | ||||||||
| Description | YABBY family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | YABBY | 47.2 | 8.8e-15 | 2 | 45 | 23 | 67 |
YABBY 23 avsvPstslfkvvtvrCGhCtsllsvnlakasqllaaeshldesl 67
vsvP +slf +vtvrCGhCt+l svn+ a q l+ + + +
Thhalv10017459m 2 KVSVPCSSLFDIVTVRCGHCTNLWSVNMVAALQSLSRPNF-QATN 45
69**************************999988877664.2222 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF04690 | 7.8E-16 | 2 | 64 | IPR006780 | YABBY protein |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0009944 | Biological Process | polarity specification of adaxial/abaxial axis | ||||
| GO:1902183 | Biological Process | regulation of shoot apical meristem development | ||||
| GO:2000024 | Biological Process | regulation of leaf development | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 110 aa Download sequence Send to blast |
MKVSVPCSSL FDIVTVRCGH CTNLWSVNMV AALQSLSRPN FQATNYAMSE HGSSSRGHTK 60 IPSRISTRTI TEQRVVNRRK PLSPSRKAAA STFCLQSIHK RGNSEDQGE* |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Promotes adaxial cell identity. Regulates the initiation of embryonic shoot apical meristem (SAM) development. {ECO:0000269|PubMed:19837869}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Thhalv10017459m |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AK353291 | 1e-139 | AK353291.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-24-G08. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_024004272.1 | 1e-50 | axial regulator YABBY 5 isoform X3 | ||||
| Swissprot | Q8GW46 | 6e-46 | YAB5_ARATH; Axial regulator YABBY 5 | ||||
| TrEMBL | V4LKW3 | 3e-75 | V4LKW3_EUTSA; Uncharacterized protein | ||||
| STRING | XP_006409726.1 | 9e-49 | (Eutrema salsugineum) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G26580.2 | 2e-48 | YABBY family protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Thhalv10017459m |
| Entrez Gene | 18027619 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




