PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10017480m
Common NameEUTSA_v10017480mg
Organism
Eutrema salsugineum
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family MYB_related
Protein Properties Length: 93aa    MW: 11543.1 Da    PI: 9.9509
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10017480mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding23.61.2e-073675445
                     S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding  4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
                     +T++E++l+ +  ++ G++ W++Ia ++  +R ++++  +w 
  Thhalv10017480m 36 MTEQEEDLIFRMYRLVGNR-WDLIAGRVA-RREANEIERYWI 75
                     79*****************.*********.***********5 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007170.00473280IPR001005SANT/Myb domain
CDDcd001671.94E-43574No hitNo description
PfamPF002494.4E-73675IPR001005SANT/Myb domain
SuperFamilySSF466891.87E-63775IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.3E-103775IPR009057Homeodomain-like
PROSITE profilePS500905.9933774IPR017877Myb-like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0080147Biological Processroot hair cell development
GO:1900033Biological Processnegative regulation of trichome patterning
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 93 aa     Download sequence    Send to blast
MDNTNRLRRL RSRKQIKFTR YDSEEVSSME WEFISMTEQE EDLIFRMYRL VGNRWDLIAG  60
RVARREANEI ERYWIMRNCD YFSNKRRQHS LN*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1512RLRRLRSR
2714RRLRSRKQ
Functional Description ? help Back to Top
Source Description
UniProtMYB-type transcription factor involved in epidermal cell fate specification. Acts as a negative regulator of trichome development, by mediating lateral inhibition. Promotes the formation of hair developing cells in H position in root epidermis, probably by inhibiting non-hair cell formation. {ECO:0000269|PubMed:15604688, ECO:0000269|PubMed:19818620}.
UniProtMYB-type transcription factor involved in trichome cell specification. Acts as a negative regulator of trichome patterning and formation. May function by suppressing the expression of GL3. {ECO:0000269|PubMed:22168948}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapThhalv10017480m
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY2344114e-64AY234411.1 Arabidopsis thaliana hypothetical protein (At2g30420) mRNA, complete cds.
GenBankAY5195204e-64AY519520.1 Arabidopsis thaliana MYB transcription factor (At2g30420) mRNA, complete cds.
GenBankAY6492554e-64AY649255.1 Arabidopsis thaliana hypothetical protein (At2g30420) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006410097.13e-61MYB-like transcription factor TCL1 isoform X1
SwissprotB3H4X83e-44TCL2_ARATH; MYB-like transcription factor TCL2
SwissprotQ84RD13e-44ETC2_ARATH; MYB-like transcription factor ETC2
TrEMBLV4LM026e-60V4LM02_EUTSA; Uncharacterized protein
STRINGXP_006410097.11e-60(Eutrema salsugineum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM32328194
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30424.11e-46MYB_related family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Wada T,Hayashi N,Tominaga-Wada R
    Root hair formation at the root-hypocotyl junction in CPC-LIKE MYB double and triple mutants of Arabidopsis.
    Plant Signal Behav, 2015. 10(11): p. e1089372
    [PMID:26339713]
  4. Huang M,Hu Y,Liu X,Li Y,Hou X
    Arabidopsis LEAFY COTYLEDON1 controls cell fate determination during post-embryonic development.
    Front Plant Sci, 2015. 6: p. 955
    [PMID:26579186]
  5. Wada T,Tominaga-Wada R
    CAPRICE family genes control flowering time through both promoting and repressing CONSTANS and FLOWERING LOCUS T expression.
    Plant Sci., 2015. 241: p. 260-5
    [PMID:26706076]
  6. Tominaga-Wada R,Wada T
    Extended C termini of CPC-LIKE MYB proteins confer functional diversity in Arabidopsis epidermal cell differentiation.
    Development, 2017. 144(13): p. 2375-2380
    [PMID:28676568]
  7. Yamada K,Sasabe M,Fujikawa Y,Wada T,Tominaga-Wada R
    Amino acid substitutions in CPC-LIKE MYB reveal residues important for protein stability in Arabidopsis roots.
    PLoS ONE, 2018. 13(10): p. e0205522
    [PMID:30308079]