![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Thhalv10017496m | ||||||||
| Common Name | EUTSA_v10017496mg | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
|
||||||||
| Family | S1Fa-like | ||||||||
| Protein Properties | Length: 77aa MW: 8123.87 Da PI: 10.7983 | ||||||||
| Description | S1Fa-like family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | S1FA | 135.6 | 1.2e-42 | 8 | 76 | 2 | 70 |
S1FA 2 avakveakGlnPGlivllvvgglllvflvgnyilyvyaqknlPPrkkkPvskkklkreklkqGvavPGe 70
++a++eakGlnPGlivllvvggll++fl++ny++y+yaqk+lPP+kkkP+skkklkreklkqGv+vPGe
Thhalv10017496m 8 GKAAAEAKGLNPGLIVLLVVGGLLVTFLIANYVMYMYAQKTLPPKKKKPISKKKLKREKLKQGVPVPGE 76
57899***************************************************************8 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF04689 | 9.5E-39 | 12 | 76 | IPR006779 | DNA binding protein S1FA |
| ProDom | PD019013 | 0.003 | 33 | 76 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0016021 | Cellular Component | integral component of membrane | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 77 aa Download sequence Send to blast |
MSSEGSAGKA AAEAKGLNPG LIVLLVVGGL LVTFLIANYV MYMYAQKTLP PKKKKPISKK 60 KLKREKLKQG VPVPGE* |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | DNA-binding protein that specifically recognizes a negative element (S1F) within the RPS1 promoter. {ECO:0000250}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Thhalv10017496m |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AF372892 | 3e-83 | AF372892.1 Arabidopsis thaliana At2g37120/T2N18.12 mRNA, complete cds. | |||
| GenBank | AY085439 | 3e-83 | AY085439.1 Arabidopsis thaliana clone 1517 mRNA, complete sequence. | |||
| GenBank | BT002669 | 3e-83 | BT002669.1 Arabidopsis thaliana At2g37120/T2N18.12 gene, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_006410892.1 | 7e-46 | DNA-binding protein S1FA2 | ||||
| Swissprot | Q42337 | 2e-28 | S1FA2_ARATH; DNA-binding protein S1FA2 | ||||
| TrEMBL | V4LP38 | 2e-44 | V4LP38_EUTSA; Uncharacterized protein | ||||
| STRING | XP_006410892.1 | 3e-45 | (Eutrema salsugineum) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G37120.1 | 5e-07 | S1FA-like DNA-binding protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Thhalv10017496m |
| Entrez Gene | 18026797 |




