![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Thhalv10017787m | ||||||||
| Common Name | EUTSA_v10017787mg | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 118aa MW: 13516.9 Da PI: 10.9199 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 42.6 | 8e-14 | 13 | 59 | 5 | 51 |
SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 5 nksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
+r +f+k r + K A L++L daevavi+fs++gkl+ ++s
Thhalv10017787m 13 QANRRPASFAKMRSRLVKNARQLCTLSDAEVAVIVFSKSGKLFQFAS 59
667999**************************************986 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00432 | 3.4E-16 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| PROSITE profile | PS50066 | 19.554 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 6.9E-15 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| SuperFamily | SSF55455 | 1.19E-20 | 3 | 80 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 1.2E-13 | 14 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 6.9E-15 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 6.9E-15 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0016021 | Cellular Component | integral component of membrane | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 118 aa Download sequence Send to blast |
MIRRKLVIKR LAQANRRPAS FAKMRSRLVK NARQLCTLSD AEVAVIVFSK SGKLFQFAST 60 SMTQMLMRYQ NYQHSSQAPL ITSKAEVSHS SAMLKSYCFF IFIHVYCFYG YSSLIRE* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1c7u_A | 1e-14 | 3 | 78 | 2 | 77 | MYOCYTE-SPECIFIC ENHANCER FACTOR 2A, C4 FORM |
| 1c7u_B | 1e-14 | 3 | 78 | 2 | 77 | MYOCYTE-SPECIFIC ENHANCER FACTOR 2A, C4 FORM |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Thhalv10017787m |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_024012192.1 | 1e-26 | agamous-like MADS-box protein AGL15 isoform X1 | ||||
| Refseq | XP_024012193.1 | 1e-26 | agamous-like MADS-box protein AGL15 isoform X2 | ||||
| Refseq | XP_024012194.1 | 1e-26 | agamous-like MADS-box protein AGL15 isoform X3 | ||||
| Swissprot | Q39295 | 9e-25 | AGL15_BRANA; Agamous-like MADS-box protein AGL15 | ||||
| TrEMBL | V4MFL6 | 6e-80 | V4MFL6_EUTSA; Uncharacterized protein | ||||
| STRING | XP_006409885.1 | 1e-80 | (Eutrema salsugineum) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G13790.1 | 6e-25 | AGAMOUS-like 15 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Thhalv10017787m |
| Entrez Gene | 18028060 |




