| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | bZIP_1 | 41.6 | 2.8e-13 | 195 | 256 | 1 | 62 |
XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
bZIP_1 1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62
e ++k+ ++++NRe+A+ sR+RKk+++eeL+ +vk++ + +L +++ e a+l+++
Thhalv10020207m 195 EDDDKKKTKMIRNRESAQLSRLRKKQYLEELQGRVKSMNSTIAELNGKISFVMAENAALRQQ 256
5789************************************9999999999988888888876 PP
|
| Publications
? help Back to Top |
- Deng Y,Srivastava R,Howell SH
Protein kinase and ribonuclease domains of IRE1 confer stress tolerance, vegetative growth, and reproductive development in Arabidopsis. Proc. Natl. Acad. Sci. U.S.A., 2013. 110(48): p. 19633-8 [PMID:24145452] - Ding Y, et al.
Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] - Nagashima Y,Iwata Y,Ashida M,Mishiba K,Koizumi N
Exogenous salicylic acid activates two signaling arms of the unfolded protein response in Arabidopsis. Plant Cell Physiol., 2014. 55(10): p. 1772-8 [PMID:25138441] - Sun L,Zhang SS,Lu SJ,Liu JX
Site-1 protease cleavage site is important for the ER stress-induced activation of membrane-associated transcription factor bZIP28 in Arabidopsis. Sci China Life Sci, 2015. 58(3): p. 270-5 [PMID:25634523] - Zhang L,Chen H,Brandizzi F,Verchot J,Wang A
The UPR branch IRE1-bZIP60 in plants plays an essential role in viral infection and is complementary to the only UPR pathway in yeast. PLoS Genet., 2015. 11(4): p. e1005164 [PMID:25875739] - Ma ZX, et al.
The THERMOSENSITIVE MALE STERILE 1 Interacts with the BiPs via DnaJ Domain and Stimulates Their ATPase Enzyme Activities in Arabidopsis. PLoS ONE, 2015. 10(7): p. e0132500 [PMID:26186593] - Sagor GH, et al.
The polyamine spermine induces the unfolded protein response via the MAPK cascade in Arabidopsis. Front Plant Sci, 2015. 6: p. 687 [PMID:26442007] - Kørner CJ,Du X,Vollmer ME,Pajerowska-Mukhtar KM
Endoplasmic Reticulum Stress Signaling in Plant Immunity--At the Crossroad of Life and Death. Int J Mol Sci, 2015. 16(11): p. 26582-98 [PMID:26556351] - Zeng Y, et al.
Unique COPII component AtSar1a/AtSec23a pair is required for the distinct function of protein ER export in Arabidopsis thaliana. Proc. Natl. Acad. Sci. U.S.A., 2015. 112(46): p. 14360-5 [PMID:26578783] - Meng Z,Ruberti C,Gong Z,Brandizzi F
CPR5 modulates salicylic acid and the unfolded protein response to manage tradeoffs between plant growth and stress responses. Plant J., 2017. 89(3): p. 486-501 [PMID:27747970] - Nawkar GM, et al.
HY5, a positive regulator of light signaling, negatively controls the unfolded protein response in Arabidopsis. Proc. Natl. Acad. Sci. U.S.A., 2017. 114(8): p. 2084-2089 [PMID:28167764] - Iwata Y, et al.
Activation of the Arabidopsis membrane-bound transcription factor bZIP28 is mediated by site-2 protease, but not site-1 protease. Plant J., 2017. 91(3): p. 408-415 [PMID:28407373] - Zhang SS, et al.
Tissue-Specific Transcriptomics Reveals an Important Role of the Unfolded Protein Response in Maintaining Fertility upon Heat Stress in Arabidopsis. Plant Cell, 2017. 29(5): p. 1007-1023 [PMID:28442596] - Ezer D, et al.
The G-Box Transcriptional Regulatory Code in Arabidopsis. Plant Physiol., 2017. 175(2): p. 628-640 [PMID:28864470] - Kataoka R,Takahashi M,Suzuki N
Coordination between bZIP28 and HSFA2 in the regulation of heat response signals in Arabidopsis. Plant Signal Behav, 2017. 12(11): p. e1376159 [PMID:28873003] - Ruberti C,Lai Y,Brandizzi F
Recovery from temporary endoplasmic reticulum stress in plants relies on the tissue-specific and largely independent roles of bZIP28 and bZIP60, as well as an antagonizing function of BAX-Inhibitor 1 upon the pro-adaptive signaling mediated by bZIP28. Plant J., 2018. 93(1): p. 155-165 [PMID:29124827] - Kim JS,Yamaguchi-Shinozaki K,Shinozaki K
ER-Anchored Transcription Factors bZIP17 and bZIP28 Regulate Root Elongation. Plant Physiol., 2018. 176(3): p. 2221-2230 [PMID:29367234]
|