![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Thhalv10027189m | ||||||||
| Common Name | EUTSA_v10027189mg | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
|
||||||||
| Family | ERF | ||||||||
| Protein Properties | Length: 137aa MW: 15286 Da PI: 8.4715 | ||||||||
| Description | ERF family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | AP2 | 48.6 | 2e-15 | 15 | 58 | 10 | 55 |
AP2 10 kkrgrWvAeIrdpsengkrkrfslgkfgtaeeAakaaiaarkkleg 55
+++g+++AeIrdp++ng +r++lg++ t+e+Aa a+++a+ +l+g
Thhalv10027189m 15 ETWGKFAAEIRDPKKNG--ARVWLGTYETPEDAAVAYDRAAFQLRG 58
57***********9998..*************************98 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51032 | 19.454 | 6 | 66 | IPR001471 | AP2/ERF domain |
| PRINTS | PR00367 | 1.0E-7 | 9 | 20 | IPR001471 | AP2/ERF domain |
| SMART | SM00380 | 2.0E-26 | 13 | 72 | IPR001471 | AP2/ERF domain |
| SuperFamily | SSF54171 | 3.4E-19 | 14 | 67 | IPR016177 | DNA-binding domain |
| Gene3D | G3DSA:3.30.730.10 | 5.0E-26 | 15 | 67 | IPR001471 | AP2/ERF domain |
| Pfam | PF00847 | 7.5E-9 | 16 | 58 | IPR001471 | AP2/ERF domain |
| CDD | cd00018 | 8.03E-24 | 17 | 68 | No hit | No description |
| PRINTS | PR00367 | 1.0E-7 | 48 | 68 | IPR001471 | AP2/ERF domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 137 aa Download sequence Send to blast |
EVKEICKQGR KQTKETWGKF AAEIRDPKKN GARVWLGTYE TPEDAAVAYD RAAFQLRGSK 60 AKLNFPHLIG SCKYEPVRIR PRRRSPEPSV SDYSSPEQKR IGHVGDGFDL DFTMNSESDG 120 GLLTDQSACS FSDSRE* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 2gcc_A | 8e-26 | 7 | 71 | 4 | 68 | ATERF1 |
| 3gcc_A | 8e-26 | 7 | 71 | 4 | 68 | ATERF1 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Acts as a transcriptional activator. Binds to the GCC-box pathogenesis-related promoter element. Involved in the regulation of gene expression by stress factors and by components of stress signal transduction pathways. {ECO:0000269|PubMed:11950980}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Thhalv10027189m |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Strongly induced by wounding. Induced by Pseudomonas syringae tomato (both virulent and avirulent avrRpt2 strains), independently of PAD4. Also induced by methyl jasmonate (MeJA) independently of JAR1, but seems to not be affected by ethylene. Induction by salicylic acid (SA) is controlled by growth and/or developmental conditions, and seems to be more efficient and independent of PAD4 in older plants. {ECO:0000269|PubMed:11950980, ECO:0000269|PubMed:12068110}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AC002388 | 2e-94 | AC002388.3 Arabidopsis thaliana chromosome 2 clone T13E15 map m336, complete sequence. | |||
| GenBank | AF325089 | 2e-94 | AF325089.1 Arabidopsis thaliana putative ethylene response element binding protein (EREBP) (At2g44840) mRNA, complete cds. | |||
| GenBank | AF370540 | 2e-94 | AF370540.1 Arabidopsis thaliana putative ethylene response element binding protein; EREBP (At2g44840; T13E15.15) mRNA, complete cds. | |||
| GenBank | AY072471 | 2e-94 | AY072471.1 Arabidopsis thaliana putative ethylene response element binding protein (EREBP) (At2g44840; T13E15.15) mRNA, complete cds. | |||
| GenBank | AY088387 | 2e-94 | AY088387.1 Arabidopsis thaliana clone 6397 mRNA, complete sequence. | |||
| GenBank | CP002685 | 2e-94 | CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_006414077.2 | 4e-98 | ethylene-responsive transcription factor 13 | ||||
| Swissprot | Q8L9K1 | 1e-64 | ERF99_ARATH; Ethylene-responsive transcription factor 13 | ||||
| TrEMBL | V4LXZ9 | 6e-97 | V4LXZ9_EUTSA; Uncharacterized protein (Fragment) | ||||
| STRING | XP_006414077.1 | 1e-97 | (Eutrema salsugineum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM10 | 28 | 1650 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G44840.1 | 8e-52 | ethylene-responsive element binding factor 13 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Thhalv10027189m |
| Entrez Gene | 18030520 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




