![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Thhalv10027470m | ||||||||
| Common Name | EUTSA_v10027470mg | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 81aa MW: 9498.33 Da PI: 10.555 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 68.3 | 7.1e-22 | 9 | 57 | 1 | 49 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
k+ie+k +r++ f+kR+ g+lKKA+EL +LCd+++a++ fs++gkl+ +
Thhalv10027470m 9 KKIEDKQQRNIAFAKRKSGLLKKAYELYILCDVQIALVFFSPSGKLFLF 57
78********************************************877 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50066 | 25.862 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
| SMART | SM00432 | 1.2E-26 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| SuperFamily | SSF55455 | 9.42E-26 | 2 | 76 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 5.0E-22 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 3.9E-22 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 5.0E-22 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 5.0E-22 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 81 aa Download sequence Send to blast |
MGRVKIQMKK IEDKQQRNIA FAKRKSGLLK KAYELYILCD VQIALVFFSP SGKLFLFDSK 60 TRIEETIHKY LELPCYRRGR * |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 6byy_A | 2e-18 | 1 | 72 | 1 | 71 | MEF2 CHIMERA |
| 6byy_B | 2e-18 | 1 | 72 | 1 | 71 | MEF2 CHIMERA |
| 6byy_C | 2e-18 | 1 | 72 | 1 | 71 | MEF2 CHIMERA |
| 6byy_D | 2e-18 | 1 | 72 | 1 | 71 | MEF2 CHIMERA |
| 6bz1_A | 2e-18 | 1 | 72 | 1 | 71 | MEF2 CHIMERA |
| 6bz1_B | 2e-18 | 1 | 72 | 1 | 71 | MEF2 CHIMERA |
| 6bz1_C | 2e-18 | 1 | 72 | 1 | 71 | MEF2 CHIMERA |
| 6bz1_D | 2e-18 | 1 | 72 | 1 | 71 | MEF2 CHIMERA |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor that forms heterodimers with the MADS-box proteins AGL30 and AGL65 and is involved in the regulation of pollen maturation at the late stages of pollen development and pollen tube growth. {ECO:0000269|PubMed:19211705}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Thhalv10027470m |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_006411890.2 | 3e-51 | truncated transcription factor CAULIFLOWER D | ||||
| Swissprot | Q9LM46 | 2e-24 | AG104_ARATH; Agamous-like MADS-box protein AGL104 | ||||
| TrEMBL | V4MKU5 | 2e-51 | V4MKU5_EUTSA; Uncharacterized protein | ||||
| STRING | XP_006411890.1 | 4e-52 | (Eutrema salsugineum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM78 | 28 | 413 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G22130.1 | 6e-27 | AGAMOUS-like 104 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Thhalv10027470m |
| Entrez Gene | 18030485 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




