![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Tp57577_TGAC_v2_mRNA12486 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
|
||||||||
| Family | NAC | ||||||||
| Protein Properties | Length: 79aa MW: 8966.01 Da PI: 4.3529 | ||||||||
| Description | NAC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NAM | 57.3 | 5.3e-18 | 28 | 75 | 1 | 48 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp 48
lppGfrFhPtdeel+++yL +k+++ ++ + ++i +vd++k+ePw+Lp
Tp57577_TGAC_v2_mRNA12486 28 LPPGFRFHPTDEELITYYLVNKISDADHFTCKAIGDVDLNKCEPWELP 75
79************************9777799**************9 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF101941 | 3.27E-18 | 23 | 77 | IPR003441 | NAC domain |
| PROSITE profile | PS51005 | 21.145 | 28 | 78 | IPR003441 | NAC domain |
| Pfam | PF02365 | 1.1E-8 | 29 | 65 | IPR003441 | NAC domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 79 aa Download sequence Send to blast |
MQKDKEVVSK EGKEMETEEG TRAKEETLPP GFRFHPTDEE LITYYLVNKI SDADHFTCKA 60 IGDVDLNKCE PWELPGSY* |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription activator of STM and KNAT6. Involved in molecular mechanisms regulating shoot apical meristem (SAM) formation during embryogenesis and organ separation. Required for the fusion of septa of gynoecia along the length of the ovaries. Activates the shoot formation in callus in a STM-dependent manner. Seems to act as an inhibitor of cell division. {ECO:0000269|PubMed:10079219, ECO:0000269|PubMed:10750709, ECO:0000269|PubMed:11245578, ECO:0000269|PubMed:12163400, ECO:0000269|PubMed:12492830, ECO:0000269|PubMed:12610213, ECO:0000269|PubMed:12787253, ECO:0000269|PubMed:14617069, ECO:0000269|PubMed:15202996, ECO:0000269|PubMed:15294871, ECO:0000269|PubMed:15500463, ECO:0000269|PubMed:15723790, ECO:0000269|PubMed:16798887, ECO:0000269|PubMed:17122068, ECO:0000269|PubMed:17287247, ECO:0000269|PubMed:9212461}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Tp57577_TGAC_v2_mRNA12486 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: By BRM, at the chromatin level, and conferring a very specific spatial expression pattern. Directly induced by ESR2 in response to cytokinins. Precise spatial regulation by post-transcriptional repression directed by the microRNA miR164. {ECO:0000269|PubMed:15202996, ECO:0000269|PubMed:15294871, ECO:0000269|PubMed:15723790, ECO:0000269|PubMed:16854978, ECO:0000269|PubMed:17056621, ECO:0000269|PubMed:17287247}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_003588574.1 | 1e-39 | protein ATAF2 isoform X1 | ||||
| Refseq | XP_024636491.1 | 1e-39 | protein ATAF2 isoform X2 | ||||
| Swissprot | Q9FRV4 | 2e-19 | NAC54_ARATH; Protein CUP-SHAPED COTYLEDON 1 | ||||
| TrEMBL | A0A2K3LIY2 | 3e-51 | A0A2K3LIY2_TRIPR; NAC domain-containing protein | ||||
| STRING | AES58825 | 4e-39 | (Medicago truncatula) | ||||
| STRING | AES58835 | 3e-39 | (Medicago truncatula) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF17584 | 5 | 7 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G24430.2 | 4e-25 | NAC domain containing protein 38 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Tp57577_TGAC_v2_mRNA12486 |




